Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

06-847 Anti-EGFR Antibody

06-847
200 µg  
Purchase on Sigma-Aldrich

Special Offers

Overview

Replacement Information

Key Spec Table

Species ReactivityKey ApplicationsHostFormatAntibody Type
H, M, R, HtIP, WBRbPurifiedPolyclonal Antibody
Description
Catalogue Number06-847
Replaces04-337; 04-338
Brand Family Upstate
Trade Name
  • Upstate
DescriptionAnti-EGFR Antibody
Alternate Names
  • Receptor tyrosine-protein kinase ErbB-1
  • avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
  • cell growth inhibiting protein 40
  • cell proliferation-inducing protein 61
  • epidermal growth factor receptor
  • epidermal growth factor receptor (avian erythroblastic leukemia viral
    (v-erb-b) oncogene homolog)
  • epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Background InformationThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
References
Product Information
FormatPurified
Control
  • A431 cell lysate, human cervical carcinoma.

    Included Positive Antigen Control:
    Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.
PresentationPurified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
Quality LevelMQ100
Applications
ApplicationAnti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
Key Applications
  • Immunoprecipitation
  • Western Blotting
Application NotesImmunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.
Biological Information
ImmunogenOvalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.
ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
HostRabbit
SpecificityRecognizes the EGFR, Mr 180 kDa.
IsotypeIgG
Species Reactivity
  • Human
  • Mouse
  • Rat
  • Hamster
Species Reactivity NoteMouse and human. Reported to detect rat and hamster.
Antibody TypePolyclonal Antibody
Entrez Gene Number
Entrez Gene SummaryThe protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq]
Gene Symbol
  • EGFR
  • ERBB1
  • ERBB
  • mENA
Purification MethodProtein A chromatography
UniProt Number
UniProt SummaryFUNCTION: SwissProt: P00533 # Isoform 2/truncated isoform may act as an antagonist.
SIZE: 1210 amino acids; 134277 Da
SUBUNIT: Binds RIPK1. CBL interacts with the autophosphorylated C- terminal tail of the EGF receptor. Part of a complex with ERBB2 and either PIK3C2A or PIK3C2B. The autophosphorylated form interacts with PIK3C2B, maybe indirectly. Interacts with PELP1.
SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. & Isoform 2: Secreted.
TISSUE SPECIFICITY: Expressed in placenta. Isoform 2 is also expressed in ovarian cancers.
PTM: Phosphorylation of Ser-695 is partial and occurs only if Thr- 693 is phosphorylated. & Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through 'Lys-63', but linkage through 'Lys-48', 'Lys-11' and 'Lys-29' also occur.DISEASE:SwissProt: P00533 # Defects in EGFR are associated with lung cancer [MIM:211980].
SIMILARITY: SwissProt: P00533 ## Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. & Contains 1 protein kinase domain.
MISCELLANEOUS: Binding of EGF to the receptor leads to dimerization, internalization of the EGF-receptor complex, induction of the tyrosine kinase activity, stimulation of cell DNA synthesis, and cell proliferation.
Molecular Weight180 kDa
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Quality AssuranceRoutinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.
Packaging Information
Material Size200 µg
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
06-847 04053252735370

Documentation

Anti-EGFR Antibody SDS

Title

Safety Data Sheet (SDS) 

Anti-EGFR Antibody Certificates of Analysis

TitleLot Number
Anti-EGFR - 2395760 2395760
Anti-EGFR - 2455633 2455633
Anti-EGFR - 17163 17163
Anti-EGFR - 2020912 2020912
Anti-EGFR - 2066054 2066054
Anti-EGFR - 2089511 2089511
Anti-EGFR - 21376 21376
Anti-EGFR - 2193153 2193153
Anti-EGFR - 2324564 2324564
Anti-EGFR - 23971 23971

References

Reference overviewApplicationPub Med ID
A leak pathway for luminal protons in endosomes drives oncogenic signalling in glioblastoma.
Kondapalli, KC; Llongueras, JP; Capilla-González, V; Prasad, H; Hack, A; Smith, C; Guerrero-Cázares, H; Quiñones-Hinojosa, A; Rao, R
Nature communications  6  6289  2015

Show Abstract
25662504 25662504
Preclinical pharmacokinetics, pharmacodynamics, and efficacy of RG7116: a novel humanized, glycoengineered anti-HER3 antibody.
Meneses-Lorente, G; Friess, T; Kolm, I; Hölzlwimmer, G; Bader, S; Meille, C; Thomas, M; Bossenmaier, B
Cancer chemotherapy and pharmacology  75  837-50  2015

Show Abstract
25702049 25702049
Constitutive and ligand-induced EGFR signalling triggers distinct and mutually exclusive downstream signalling networks.
Chakraborty, S; Li, L; Puliyappadamba, VT; Guo, G; Hatanpaa, KJ; Mickey, B; Souza, RF; Vo, P; Herz, J; Chen, MR; Boothman, DA; Pandita, TK; Wang, DH; Sen, GC; Habib, AA
Nature communications  5  5811  2014

Show Abstract
25503978 25503978
Regulation of fibroblast growth factor-inducible 14 (Fn14) expression levels via ligand-independent lysosomal degradation.
Gurunathan, S; Winkles, JA; Ghosh, S; Hayden, MS
The Journal of biological chemistry  289  12976-88  2014

Show Abstract
24652288 24652288
Malignant peripheral nerve sheath tumor invasion requires aberrantly expressed EGF receptors and is variably enhanced by multiple EGF family ligands.
Byer, SJ; Brossier, NM; Peavler, LT; Eckert, JM; Watkins, S; Roth, KA; Carroll, SL
Journal of neuropathology and experimental neurology  72  219-33  2013

Show Abstract
Western Blotting23399900 23399900
Nonmuscle Myosin II Is Required for Internalization of the Epidermal Growth Factor Receptor and Modulation of Downstream Signaling.
Jong Hyun Kim,Aibing Wang,Mary Anne Conti,Robert S Adelstein
The Journal of biological chemistry  287  2012

Show Abstract
22718763 22718763
Regulated intramembrane cleavage of the EGF receptor.
Hong-Jun Liao,Graham Carpenter
Traffic (Copenhagen, Denmark)  13  2012

Show Abstract
22531034 22531034
Epidermal growth factor receptor-targeted photosensitizer selectively inhibits EGFR signaling and induces targeted phototoxicity in ovarian cancer cells.
Abu-Yousif, AO; Moor, AC; Zheng, X; Savellano, MD; Yu, W; Selbo, PK; Hasan, T
Cancer letters  321  120-7  2012

Show Abstract
22266098 22266098
Frank-ter Haar Syndrome Protein Tks4 Regulates Epidermal Growth Factor-dependent Cell Migration.
G B,Annam Gujd,Mikl Geiszt,Arp L,Anna Fekete,Szabolcs Sipeki,Julian Downward,L Buday,Gábor Bögel,Annamária Gujdár,Miklós Geiszt,Arpád Lányi,László Buday
The Journal of biological chemistry  287  2012

Show Abstract
22829589 22829589
The role of MMP-1 in breast cancer growth and metastasis to the brain in a xenograft model.
Liu, H; Kato, Y; Erzinger, SA; Kiriakova, GM; Qian, Y; Palmieri, D; Steeg, PS; Price, JE
BMC cancer  12  583  2012

Show Abstract
Western Blotting23217186 23217186

Related Products & Applications

Related Products

Included Positive Control

Catalogue Number Description
12-305 3T3/A31 Cell Lysate

Product Families

Categories

Life Science Research > Antibodies and Assays > Primary Antibodies