Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

06-596 Anti-STAT3 Antibody

View Products on Sigmaaldrich.com
06-596
200 µg  
Purchase on Sigma-Aldrich

Special Offers

Overview

Replacement Information

Key Spec Table

Species ReactivityKey ApplicationsHostFormatAntibody Type
H, M, REMSA, ICC, IP, WB, ChIPRbPurifiedPolyclonal Antibody
Description
Catalogue Number06-596
Replaces04-1014
Brand Family Upstate
Trade Name
  • Upstate
DescriptionAnti-STAT3 Antibody
Alternate Names
  • Acute-phase response factor
  • DNA-binding protein APRF
  • signal transducer and activator of transcription
  • signal transducer and activator of transcription
  • (acute-phase response factor)
Background InformationSTAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.
References
Product Information
FormatPurified
Control
  • EGF-stimulated A431 cells
PresentationProtein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.
Quality LevelMQ100
Applications
ApplicationAnti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
Key Applications
  • Electrophoretic Mobility Shift Assay
  • Immunocytochemistry
  • Immunoprecipitation
  • Western Blotting
  • Chromatin Immunoprecipitation (ChIP)
Application NotesImmunoprecipitation:
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Biological Information
ImmunogenBacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Epitopea.a. 688-722
ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
HostRabbit
SpecificityRecognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.
IsotypeIgG
Species Reactivity
  • Human
  • Mouse
  • Rat
Antibody TypePolyclonal Antibody
Entrez Gene Number
Entrez Gene SummaryThe protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Gene Symbol
  • APRF
  • FLJ20882
  • HIES
  • MGC16063
Purification MethodProtein A Purfied
UniProt Number
UniProt SummaryFUNCTION: SwissProt: P40763 # Transcription factor that binds to the interleukin-6 (IL-6)-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA.
SIZE: 770 amino acids; 88068 Da
SUBUNIT: Forms a homodimer or a heterodimer with a related family member (at least STAT1). Interacts with NCOA1, PELP1, SOCS7 and STATIP1. Interacts with HCV core protein. Interacts with IL23R in presence of IL23. Interacts with IL31RA.
SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
PTM: Tyrosine phosphorylated in response to IL-6, IL-11, CNTF, LIF, CSF-1, EGF, PDGF, IFN-alpha and OSM. Phosphorylated on serine upon DNA damage, probably by ATM or ATR. Serine phosphorylation is important for the formation of stable DNA-binding STAT3 homodimers and maximal transcriptional activity.
DISEASE: "SwissProt: P40763 # Defects in STAT3 are the cause of hyperimmunoglobulin E recurrent infection syndrome autosomal dominant (AD-HIES) [MIM:147060]; also known as hyper-IgE syndrome or Job syndrome. AD-HIES is a rare disorder of immunity and connective tissue characterized by immunodeficiency, chronic eczema, recurrent Staphylococcal infections, increased serum IgE, eosinophilia, distinctive coarse facial appearance, abnormal dentition, hyperextensibility of the joints, and bone fractures."
SIMILARITY: SwissProt: P40763 ## Belongs to the transcription factor STAT family. & Contains 1 SH2 domain.
MISCELLANEOUS: Involved in the gp130-mediated signaling pathway.
Molecular Weight92 kDa
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Quality AssuranceRoutinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.

Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Packaging Information
Material Size200 µg
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
06-596 04053252589409

Documentation

Anti-STAT3 Antibody MSDS

Title

Safety Data Sheet (SDS) 

Anti-STAT3 Antibody Certificates of Analysis

TitleLot Number
Anti-STAT3 - 2453259 2453259
Anti-STAT3 - 15772 15772
Anti-STAT3 - 17470 17470
Anti-STAT3 - 1951972 1951972
Anti-STAT3 - 2019513 2019513
Anti-STAT3 - 2040087 2040087
Anti-STAT3 - 2189947 2189947
Anti-STAT3 - 22775 22775
Anti-STAT3 - 2309071 2309071
Anti-STAT3 - 24010 24010

References

Reference overviewApplicationSpeciesPub Med ID
Jak1/Stat3 is an upstream signaling of NF-κB activation in Helicobacter pylori-induced IL-8 production in gastric epithelial AGS cells.
Cha, B; Lim, JW; Kim, H
Yonsei medical journal  56  862-6  2015

Show Abstract
25837197 25837197
Glutamine Deprivation Causes Hydrogen Peroxide-induced Interleukin-8 Expression via Jak1/Stat3 Activation in Gastric Epithelial AGS Cells.
Lee, YM; Kim, MJ; Kim, Y; Kim, H
Journal of cancer prevention  20  179-84  2015

Show Abstract
26473156 26473156
Radiation-enhanced lung cancer progression in a transgenic mouse model of lung cancer is predictive of outcomes in human lung and breast cancer.
Delgado, O; Batten, KG; Richardson, JA; Xie, XJ; Gazdar, AF; Kaisani, AA; Girard, L; Behrens, C; Suraokar, M; Fasciani, G; Wright, WE; Story, MD; Wistuba, II; Minna, JD; Shay, JW
Clinical cancer research : an official journal of the American Association for Cancer Research  20  1610-22  2014

Show Abstract
24486591 24486591
A novel role for histone deacetylase 6 in the regulation of the tolerogenic STAT3/IL-10 pathway in APCs.
Cheng, F; Lienlaf, M; Wang, HW; Perez-Villarroel, P; Lee, C; Woan, K; Rock-Klotz, J; Sahakian, E; Woods, D; Pinilla-Ibarz, J; Kalin, J; Tao, J; Hancock, W; Kozikowski, A; Seto, E; Villagra, A; Sotomayor, EM
Journal of immunology (Baltimore, Md. : 1950)  193  2850-62  2014

Show Abstract
25108026 25108026
Nucleolar protein trafficking in response to HIV-1 Tat: rewiring the nucleolus.
Jarboui, MA; Bidoia, C; Woods, E; Roe, B; Wynne, K; Elia, G; Hall, WW; Gautier, VW
PloS one  7  e48702  2012

Show Abstract
Western Blotting23166591 23166591
Preclinical characterization of atiprimod, a novel JAK2 AND JAK3 inhibitor.
Alfonso Quintás-Cardama,Taghi Manshouri,Zeev Estrov,David Harris,Ying Zhang,Amos Gaikwad,Hagop M Kantarjian,Srdan Verstovsek
Investigational new drugs  29  2011

Show Abstract
20372971 20372971
NFĸB is an unexpected major mediator of interleukin-15 signaling in cerebral endothelia.
Stone, KP; Kastin, AJ; Pan, W
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology  28  115-24  2011

Show Abstract
21865854 21865854
Bone marrow stroma-secreted cytokines protect JAK2(V617F)-mutated cells from the effects of a JAK2 inhibitor.
Manshouri, T; Estrov, Z; Quintás-Cardama, A; Burger, J; Zhang, Y; Livun, A; Knez, L; Harris, D; Creighton, CJ; Kantarjian, HM; Verstovsek, S
Cancer research  71  3831-40  2011

Show Abstract
21512135 21512135
Histone deacetylase inhibitor LAQ824 augments inflammatory responses in macrophages through transcriptional regulation of IL-10.
Wang, H; Cheng, F; Woan, K; Sahakian, E; Merino, O; Rock-Klotz, J; Vicente-Suarez, I; Pinilla-Ibarz, J; Wright, KL; Seto, E; Bhalla, K; Villagra, A; Sotomayor, EM
Journal of immunology (Baltimore, Md. : 1950)  186  3986-96  2011

Show Abstract
Western Blotting21368229 21368229
Nuclear expression of a group II intron is consistent with spliceosomal intron ancestry.
Chalamcharla VR, Curcio MJ, Belfort M
Genes Dev  24  827-36. Epub 2010 Mar 29.  2010

Show Abstract Full Text Article
20351053 20351053

Technical Info

Title
JAK/STAT Signaling Research Focus