Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

MAB2290 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

View Products on Sigmaaldrich.com
MAB2290
100 µg  
Purchase on Sigma-Aldrich

Special Offers

Overview

Replacement Information

Key Spec Table

Species ReactivityKey ApplicationsHostFormatAntibody Type
HWB, ICC, IHCMPurifiedMonoclonal Antibody
Description
Catalogue NumberMAB2290
Brand Family Chemicon®
Trade Name
  • Chemicon
DescriptionAnti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3
OverviewMAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
Alternate Names
  • CD49c
Background InformationIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.
References
Product Information
FormatPurified
PresentationPurified. Liquid in PBS containing 0.01% sodium azide.
Quality LevelMQ100
Applications
ApplicationAnti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Key Applications
  • Western Blotting
  • Immunocytochemistry
  • Immunohistochemistry
Application NotesWestern Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.
Biological Information
ImmunogenSynthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
Epitopecytoplasmic domain
Clone29A3
ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
HostMouse
SpecificityAnti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
IsotypeIgG1
Species Reactivity
  • Human
Antibody TypeMonoclonal Antibody
Entrez Gene Number
Entrez Gene SummaryITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 ('VLA-3'), very common antigen 2 ('VCA-2'), extracellular matrix receptor 1 ('ECMR1'), and galactoprotein b3 ('GAPB3').
Gene Symbol
  • ITGA3
  • FRP-2
  • GAP-B3
  • CD49c
  • FLJ34704
  • MSK18
  • VL3A
  • VLA3a
  • GAPB3
  • CD49C
  • VCA-2
  • FLJ34631
UniProt Number
UniProt SummaryFUNCTION: SwissProt: P26006 # Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha- 3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.
SIZE: 1066 amino acids; 118698 Da
SUBUNIT: Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.
SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
TISSUE SPECIFICITY: Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells.
PTM: Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12- myristate 13-acetate stimulation.
SIMILARITY: SwissProt: P26006 ## Belongs to the integrin alpha chain family. & Contains 7 FG-GAP repeats.
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStore at 2-8°C, or in small aliquots at -20°C.
Packaging Information
Material Size100 µg
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
MAB2290 04053252397578

Documentation

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 MSDS

Title

Safety Data Sheet (SDS) 

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 Certificates of Analysis

TitleLot Number
MOUSE ANTI-INTEGRIN ALPHA 3A - 3584368 3584368
MOUSE ANTI-INTEGRIN ALPHA 3A - 4137659 4137659
MOUSE ANTI-INTEGRIN ALPHA 3A -2607895 2607895
MOUSE ANTI-INTEGRIN ALPHA 3A MONOCLONAL ANTIBODY 2908078

References

Reference overviewApplicationSpeciesPub Med ID
Canine malignant melanoma alpha-3 integrin binding peptides.
Aina, OH; Maeda, Y; Harrison, M; Zwingenberger, AL; Walker, NJ; Lam, KS; Kent, MS
Veterinary immunology and immunopathology  143  11-9  2011

Show Abstract
21722969 21722969
A proteomic approach to identify candidate substrates of human adenovirus E4orf6-E1B55K and other viral cullin-based E3 ubiquitin ligases.
Dallaire, F; Blanchette, P; Branton, PE
Journal of virology  83  12172-84  2009

Show Abstract Full Text Article
19759146 19759146
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology : JASN  19  1079-91  2008

Show Abstract Full Text Article
Western Blotting, ImmunoprecipitationRabbit18337486 18337486

Data Sheet

Title
MOUSE ANTI-INTEGRIN ALPHA 3A