613571 Sigma-AldrichTIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem
The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
More>> The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications. Less<<Synonyms: Ant-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
Recommended Products
Overview
Replacement Information |
---|
Key Spec Table
Empirical Formula |
---|
C₁₆₃H₂₆₈N₅₂O₃₈S |
Pricing & Availability
Catalogue Number | Availability | Packaging | Qty/Pack | Price | Quantity | |
---|---|---|---|---|---|---|
613571-1MG |
|
Plastic ampoule | 1 mg |
|
— |
Description | |
---|---|
Overview | A cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570). |
Catalogue Number | 613571 |
Brand Family | Calbiochem® |
Synonyms | Ant-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL) |
References | |
---|---|
References | Horng, T., et al. 2001. Nat. Immunol. 2, 835. |
Product Information | |
---|---|
ATP Competitive | N |
Form | White lyophilized solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₁₆₃H₂₆₈N₅₂O₃₈S |
Chemical formula | C₁₆₃H₂₆₈N₅₂O₃₈S |
Hygroscopic | Hygroscopic |
Reversible | N |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | Control for TIRAP inhibitor |
Purity | ≥97% by HPLC |
Physicochemical Information | |
---|---|
Cell permeable | Y |
Peptide Sequence | H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalogue Number | GTIN |
613571-1MG | 04055977263565 |
Documentation
TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem MSDS
Title |
---|
TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem Certificates of Analysis
Title | Lot Number |
---|---|
613571 |
References
Reference overview |
---|
Horng, T., et al. 2001. Nat. Immunol. 2, 835. |