Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

Overview

Replacement Information

Key Spec Table

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
05-23-2005-0.5MG
Retrieving availability...
Limited Availability
Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Glass bottle .5 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      05-23-2005-1MG
      Retrieving availability...
      Limited Availability
Limited Availability
      In Stock 
      Discontinued
      Limited Quantities Available
      Availability to be confirmed
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Plastic ampoule 1 mg
          Retrieving price...
          Price could not be retrieved
          Minimum Quantity is a multiple of
          Maximum Quantity is
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          Catalogue Number05-23-2005
          Brand Family Calbiochem®
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          References
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Product Information
          CAS number90880-35-6
          ATP CompetitiveN
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          ReversibleY
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetA potent vasoconstrictor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          R PhraseR: 20/21/22

          Harmful by inhalation, in contact with skin and if swallowed.
          S PhraseS: 36

          Wear suitable protective clothing.
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Harmful
          Storage -20°C
          Protect from Moisture Protect from moisture
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications
          Global Trade Item Number
          Catalogue Number GTIN
          05-23-2005-0.5MG 04055977206371
          05-23-2005-1MG 04055977206388

          Documentation

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem MSDS

          Title

          Safety Data Sheet (SDS) 

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificates of Analysis

          TitleLot Number
          05-23-2005

          References

          Reference overview
          Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Data Sheet

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision18-September-2008 RFH
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          CAS number90880-35-6
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Purity≥97% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage Protect from moisture
          -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Harmful
          Merck USA index14, 6485
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.