481906 Sigma-AldrichAnti-Nicastrin, N-Terminal (62-93) Rabbit pAb
Recommended Products
Overview
Replacement Information |
---|
Key Spec Table
Host |
---|
Rb |
Description | |
---|---|
Overview | This product has been discontinued. |
Catalogue Number | 481906 |
Brand Family | Calbiochem® |
Synonyms | Anti-SP716 |
References | |
---|---|
References | Leem, J.Y., et al. 2002. J. Biol. Chem. 277, 19236. Yu, G., et al. 2000. Nature 407, 34. |
Product Information | |
---|---|
Form | Liquid |
Formulation | Undiluted serum. |
Preservative | None |
Biological Information | |
---|---|
Immunogen | a synthetic peptide (CQSSISGDTGVIHVVEKEEDLKWVLTDGPNPP) corresponding to amino acids 62-93 of human nicastrin, conjugated to KLH |
Immunogen | Human |
Host | Rabbit |
Isotype | IgG |
Physicochemical Information |
---|
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalogue Number | GTIN |
481906 | 0 |
Documentation
Anti-Nicastrin, N-Terminal (62-93) Rabbit pAb Certificates of Analysis
Title | Lot Number |
---|---|
481906 |
References
Reference overview |
---|
Leem, J.Y., et al. 2002. J. Biol. Chem. 277, 19236. Yu, G., et al. 2000. Nature 407, 34. |