Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

613571
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Products

Catalogue NumberPackaging Qty/Pack
613571-1MG Plastová ampulka 1 mg
Description
OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
Catalogue Number613571
Brand Family Calbiochem®
SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
References
ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
Product Information
ATP CompetitiveN
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
Hygroscopic Hygroscopic
ReversibleN
Quality LevelMQ100
Applications
Biological Information
Primary TargetControl for TIRAP inhibitor
Purity≥97% by HPLC
Physicochemical Information
Cell permeableY
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Blue Ice Only
Toxicity Standard Handling
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
613571-1MG 04055977263565

Documentation

TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem MSDS

Title

Safety Data Sheet (SDS) 

TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem Certificates of Analysis

TitleLot Number
613571

References

Reference overview
Horng, T., et al. 2001. Nat. Immunol. 2, 835.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision12-September-2008 RFH
SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
DescriptionA cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Intert gas (Yes/No) Packaged under inert gas
Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
Purity≥97% by HPLC
SolubilityDMSO (5 mg/ml)
Storage Protect from light
-20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Standard Handling
ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.