219483 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem
Synonyms: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
Recommended Products
-
1467510020 Millipore Readyplate XLD Agar acc ISO 6579 -
MAB8906-KC Sigma-Aldrich Anti-Measles, nucleoprotein, clone 83KKII (1mg) KC -
115228 Millipore Kyselina N,N-bis(2-hydroxyetyl)-2-aminoetánsulfónová -
341492 Sigma-Aldrich FeTPPS - Calbiochem -
MABF3366-25UG Sigma-Aldrich Anti-Adenovirus 5 DBP Antibody, clone B6-8 -
ABC1687-100UG Sigma-Aldrich Anti-Heparanase-1 -
557440 Sigma-Aldrich Ru360 - Calbiochem -
ALP30 Sigma-Aldrich Apolipoprotein B, human -
MABS2229-100UG Sigma-Aldrich Anti-UGT1A9 Antibody, clone 14G11 -
820617 Sigma-Aldrich O-Benzylhydroxylamín
Overview
Key Spec Table
Empirical Formula |
---|
C₂₂₈H₃₃₅N₆₁O₄₉S |
Description | |
---|---|
Overview | This product has been discontinued. A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
Catalogue Number | 219483 |
Brand Family | Calbiochem® |
Synonyms | AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY |
References | |
---|---|
References | Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |
Product Information | |
---|---|
ATP Competitive | N |
Form | White lyophilized solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Hygroscopic | Hygroscopic |
Reversible | N |
Quality Level | MQ100 |
Biological Information | |
---|---|
Primary Target | Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
Purity | ≥95% by HPLC |
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Global Trade Item Number | |
---|---|
Catalogue Number | GTIN |
219483 | 0 |