Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

219483 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem

219483
  
Purchase on Sigma-Aldrich

Overview

Key Spec Table

Empirical Formula
C₂₂₈H₃₃₅N₆₁O₄₉S
Description
Overview

This product has been discontinued.



A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Catalogue Number219483
Brand Family Calbiochem®
SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
References
ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Product Information
ATP CompetitiveN
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
Hygroscopic Hygroscopic
ReversibleN
Quality LevelMQ100
Biological Information
Primary TargetNegative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
Purity≥95% by HPLC
Physicochemical Information
Cell permeableN
Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
Storage and Shipping Information
Ship Code Shipped with Blue Ice or with Dry Ice
Toxicity Standard Handling
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Global Trade Item Number
Catalogue Number GTIN
219483 0