Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

532385 CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem

kinase II inhibitor, TATCN21; tatCN21

CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: tat-fused CN21

Primary Target: CaMKII
532385
Purchase on Sigma-Aldrich

Overview

Replacement Information

Products

Catalogue NumberPackaging Qty/Pack
5.32385.0001 Sklená flaša 1 set
Description
OverviewA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both α and β isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
Catalogue Number532385
Brand Family Calbiochem®
Synonymstat-fused CN21
References
ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.
Product Information
FormSolid
FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
Hygroscopic Hygroscopic
Quality LevelMQ100
Applications
Biological Information
Primary TargetCaMKII
Primary Target IC<sub>50</sub>~5 µ
Purity≥95% by HPLC
Physicochemical Information
Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Shipped at Ambient Temperature or with Blue Ice or with Dry Ice
Toxicity Standard Handling
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
5.32385.0001 04055977287233

Documentation

CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem MSDS

Title

Safety Data Sheet (SDS) 

References

Reference overview
Liu, X., et al. 2014. Neuropsychopharm. 29, 989.
Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.

Technical Info

Title
White Paper: Further considerations of antibody validation and usage.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision28-January-2015 JSW
Synonymstat-fused CN21
DescriptionA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~ 5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both a and b isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
FormSolid
FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
Intert gas (Yes/No) Packaged under inert gas
Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
Purity≥95% by HPLC
SolubilityH₂O (50 mg/ml)
Storage Protect from light
-20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
Toxicity Standard Handling
ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.