508512 Sigma-AldrichSNX-482 - CAS 203460-30-4 - Calbiochem
A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC₅₀ = 15-30 nM).
More>> A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC₅₀ = 15-30 nM). Less<<Recommended Products
-
AB5566 Sigma-Aldrich Anti-Capsaicin Receptor Antibody, CT -
800753 Sigma-Aldrich Kyselina sebaková -
RAWP29325 Millipore MF-Millipore Membrane, mixed cellulose esters, Hydrophilic, 1.2 µm, 293 mm, white, plain -
150033 Supelco Hibar® 125-4 Purospher® STAR RP-8e (5 µm) -
SAMP2GPNK Millipore Millex-GP Filter for Samplicity G2, 0.22 µm, PES 33 mm, non-sterile -
178251 Sigma-Aldrich α₁-Antitrypsin, Human Plasma - CAS 9041-92-3 - Calbiochem -
150424 Supelco Chromolith® CapRod® RP-18 endcapped 300-0.1 capillary column -
YG-10ML-SAM Sigma-Aldrich YG, Anti-Toxo FFMU MS-415 10ML Sample
Přehled
Tabulka spec. kláve
CAS # | Empirical Formula |
---|---|
203460-30-4 | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Products
Katalogové číslo | Balení | ks/bal. | |
---|---|---|---|
5.08512.0001 | Skleněná láhev | 10 μg |
References | |
---|---|
References | Abitbol, K. et al. 2012. J. Physiol. 590, 2977. Newcomb, R., et al., 1998. Biochemistry. 37, 15353. |
Product Information | |
---|---|
CAS number | 203460-30-4 |
Form | White solid |
Hill Formula | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Chemical formula | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Quality Level | MQ100 |
Biological Information | |
---|---|
Primary Target | Cav2.3 channels |
Primary Target IC<sub>50</sub> | 15-30 nM |
Purity | ≥98% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLF→SYCAWDLTFSD (difulfid bond: 7-21, 14-26, 20-33) |
Global Trade Item Number | |
---|---|
Katalogové číslo | GTIN |
5.08512.0001 | 04055977262049 |