Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

05-23-2350 Galanin, Porcine

Galanin, Porcine MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂

05-23-2350
  
Purchase on Sigma-Aldrich

Přehled

Replacement Information

Tabulka spec. kláve

CAS #Empirical Formula
88813-36-9C₁₄₆H₂₁₃N₄₃O₄₀
Description
OverviewA biologically active neuropeptide that has been shown to inhibit secretion of somatostatin, insulin, and pancreatic polypeptide. Also induces repolarization and reduces free Ca2+ due to interference with voltage-activated Ca2+ channels. Inhibits ω-conotoxin GVIA-sensitive Ca2+ channels in parasympathetic neurons. Reported to have an inhibitory role in transmission of nociceptive information.
Catalogue Number05-23-2350
Brand Family Calbiochem®
SynonymsGWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂
References
ReferencesYu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.
Product Information
CAS number88813-36-9
FormWhite to off-white lyophilized solid
FormulationSold on the basis of peptide content.
Hill FormulaC₁₄₆H₂₁₃N₄₃O₄₀
Chemical formulaC₁₄₆H₂₁₃N₄₃O₄₀
Sold on the basis of peptide contentY
Applications
Biological Information
Purity≥97% by HPLC
Physicochemical Information
Peptide ContentY
Peptide SequenceH-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH₂
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C to 0°C
Protect from Moisture Protect from moisture
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Katalogové číslo GTIN
05-23-2350 0

Documentation

Galanin, Porcine Certificates of Analysis

TitleLot Number
05-23-2350

References

Přehled odkazů
Yu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision17-October-2007 JSW
SynonymsGWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH₂
DescriptionA biologically active neuropeptide consisting of 29 amino acids. Shown to inhibit secretion of somatostatin, insulin and pancreatic polypeptide. Also induces repolarization and reduces free Ca2+ due to interference with voltage-activated Ca2+ channels. Inhibits ω-conotoxin GVIA-sensitive Ca2+ channels in parasympathetic neurons. Reported to have an inhibitory role in transmission of nociceptive information.
FormWhite to off-white lyophilized solid
FormulationSold on the basis of peptide content.
CAS number88813-36-9
Chemical formulaC₁₄₆H₂₁₃N₄₃O₄₀
Peptide SequenceH-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH₂
Purity≥97% by HPLC
Solubility5% Acetic acid (1 mg/ml)
Storage Protect from moisture
-20°C to 0°C
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Standard Handling
ReferencesYu, L., et al. 2001. Regul. Pept. 101, 179. Merriam, L.A., and Parsons, R.L. 1995. J. Neurophysiol. 73, 1374. Homaidan, F.R. 1991. Proc. Natl. Acad. Sci. USA 88, 8744. Lindskog, S., and Ahren, B. 1991. Eur. J. Pharmacol. 205, 21. Ahren, B., et al. 1988. FEBS Lett. 229, 233. Tatemoto, K., et al. 1983. FEBS Lett. 164, 124.