Millipore Sigma Vibrant Logo

MAB2290 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

View Products on Sigmaaldrich.com
MAB2290
100 µg  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited Availability
Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      HWB, ICC, IHCMPurifiedMonoclonal Antibody
      Description
      Catalogue NumberMAB2290
      Brand Family Chemicon®
      Trade Name
      • Chemicon
      DescriptionAnti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3
      OverviewMAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
      Alternate Names
      • CD49c
      Background InformationIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.
      References
      Product Information
      FormatPurified
      PresentationPurified. Liquid in PBS containing 0.01% sodium azide.
      Quality LevelMQ100
      Applications
      ApplicationAnti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
      Key Applications
      • Western Blotting
      • Immunocytochemistry
      • Immunohistochemistry
      Application NotesWestern Blot

      Immunocytochemistry

      Immunohistochemistry (Frozen Sections)

      Optimal working dilutions must be determined by the end user.
      Biological Information
      ImmunogenSynthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
      Epitopecytoplasmic domain
      Clone29A3
      ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
      HostMouse
      SpecificityAnti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

      SPECIES REACTIVITIES:

      Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
      IsotypeIgG1
      Species Reactivity
      • Human
      Antibody TypeMonoclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 ('VLA-3'), very common antigen 2 ('VCA-2'), extracellular matrix receptor 1 ('ECMR1'), and galactoprotein b3 ('GAPB3').
      Gene Symbol
      • ITGA3
      • FRP-2
      • GAP-B3
      • CD49c
      • FLJ34704
      • MSK18
      • VL3A
      • VLA3a
      • GAPB3
      • CD49C
      • VCA-2
      • FLJ34631
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P26006 # Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha- 3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.
      SIZE: 1066 amino acids; 118698 Da
      SUBUNIT: Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.
      SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
      TISSUE SPECIFICITY: Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells.
      PTM: Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12- myristate 13-acetate stimulation.
      SIMILARITY: SwissProt: P26006 ## Belongs to the integrin alpha chain family. & Contains 7 FG-GAP repeats.
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsStore at 2-8°C, or in small aliquots at -20°C.
      Packaging Information
      Material Size100 µg
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      MAB2290 04053252397578

      Documentation

      Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 MSDS

      Title

      Safety Data Sheet (SDS) 

      Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 Certificates of Analysis

      TitleLot Number
      MOUSE ANTI-INTEGRIN ALPHA 3A - 3584368 3584368
      MOUSE ANTI-INTEGRIN ALPHA 3A - 4137659 4137659
      MOUSE ANTI-INTEGRIN ALPHA 3A -2572764 2572764
      MOUSE ANTI-INTEGRIN ALPHA 3A -2578615 2578615
      MOUSE ANTI-INTEGRIN ALPHA 3A -2584356 2584356
      MOUSE ANTI-INTEGRIN ALPHA 3A -2607895 2607895
      MOUSE ANTI-INTEGRIN ALPHA 3A MONOCLONAL ANTIBODY 2908078

      References

      Reference overviewApplicationSpeciesPub Med ID
      Canine malignant melanoma alpha-3 integrin binding peptides.
      Aina, OH; Maeda, Y; Harrison, M; Zwingenberger, AL; Walker, NJ; Lam, KS; Kent, MS
      Veterinary immunology and immunopathology  143  11-9  2011

      Show Abstract
      21722969 21722969
      A proteomic approach to identify candidate substrates of human adenovirus E4orf6-E1B55K and other viral cullin-based E3 ubiquitin ligases.
      Dallaire, F; Blanchette, P; Branton, PE
      Journal of virology  83  12172-84  2009

      Show Abstract Full Text Article
      19759146 19759146
      Role of integrins in the assembly and function of hensin in intercalated cells.
      Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
      Journal of the American Society of Nephrology : JASN  19  1079-91  2008

      Show Abstract Full Text Article
      Western Blotting, ImmunoprecipitationRabbit18337486 18337486

      Data Sheet

      Title
      MOUSE ANTI-INTEGRIN ALPHA 3A

      Related Products & Applications

      Related Products

      Catalogue Number Description  
      AB1920 Anti-Integrin α3 Antibody Show Pricing & Availability
      MAB1952Z Anti-Integrin α3 Antibody, clone P1B5, azide free Show Pricing & Availability
      MAB1992 Anti-Integrin α3β1 Antibody, clone M-KID2 Show Pricing & Availability
      MAB2056 Anti-Integrin α3 Antibody, clone ASC-1 Show Pricing & Availability
      MAB2056Z Anti-Integrin α3 Antibody, clone ASC-1 (Azide Free) Show Pricing & Availability
      MAB2057 Anti-Integrin α3 Antibody, clone ASC-6 Show Pricing & Availability
      MAB2291 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3 Show Pricing & Availability

      Categories

      Life Science Research > Antibodies and Assays > Primary Antibodies