171596 Sigma-Aldrichβ-Amyloid Peptide (1-42), Rat
Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
More>> Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons. Less<<Synonyms: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Recommended Products
Overview
Replacement Information |
---|
Pricing & Availability
Catalogue Number | Availability | Packaging | Qty/Pack | Price | Quantity | |
---|---|---|---|---|---|---|
171596-250UG |
|
Plastic ampoule | 250 μg |
|
— |
Product Information | |
---|---|
CAS number | 107761-42-2 |
Form | Lyophilized |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Chemical formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Hygroscopic | Hygroscopic |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥80% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalogue Number | GTIN |
171596-250UG | 04055977207286 |
Documentation
β-Amyloid Peptide (1-42), Rat MSDS
Title |
---|
β-Amyloid Peptide (1-42), Rat Certificates of Analysis
Title | Lot Number |
---|---|
171596 |
References
Reference overview |
---|
Paradis, E., et al. 1996. J. Neurosci. 16, 7533. Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631. Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701. Murrell, J., et al. 1991. Science 254, 97. Goldgaber, D., et al. 1987. Science 235, 877. Kang, J., et al. 1987. Nature 325, 733. |
Brochure
Title |
---|
Alzheimer's Disease Brochure & Technical Guide |