Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

219483 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem

MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY

Primary Target: Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
219483
  
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Empirical Formula
C₂₂₈H₃₃₅N₆₁O₄₉S
Description
Overview

This product has been discontinued.



A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
Catalogue Number219483
Brand Family Calbiochem®
SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
References
ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Product Information
ATP CompetitiveN
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
Hygroscopic Hygroscopic
ReversibleN
Quality LevelMQ100
Applications
Biological Information
Primary TargetNegative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
Purity≥95% by HPLC
Physicochemical Information
Cell permeableN
Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Shipped with Blue Ice or with Dry Ice
Toxicity Standard Handling
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
219483 0

Documentation

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem SDS

Title

Safety Data Sheet (SDS) 

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem Certificates of Analysis

TitleLot Number
219483

References

Reference overview
Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision16-November-2020 JSW
SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
DescriptionA scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Intert gas (Yes/No) Packaged under inert gas
Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
Purity≥95% by HPLC
SolubilityDMSO (2 mg/ml)
Storage Protect from light
-20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Standard Handling
ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.