Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

613571
Purchase on Sigma-Aldrich

Przegląd

Tabela kluczowych gatunków

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Products

Numer katalogowyOpakowanie Ilość/opak.
613571-1MG Ampulka plastikowa 1 mg
Description
OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
Catalogue Number613571
Brand Family Calbiochem®
SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
References
ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
Product Information
ATP CompetitiveN
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
Hygroscopic Hygroscopic
ReversibleN
Quality LevelMQ100
Biological Information
Primary TargetControl for TIRAP inhibitor
Purity≥97% by HPLC
Physicochemical Information
Cell permeableY
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
Storage and Shipping Information
Ship Code Blue Ice Only
Toxicity Standard Handling
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Global Trade Item Number
Numer katalogowy GTIN
613571-1MG 04055977263565