Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Primary Target: Adenylate cyclase
05-23-2150
Purchase on Sigma-Aldrich

Przegląd

Replacement Information

Tabela kluczowych gatunków

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

Products

Numer katalogowyOpakowanie Ilość/opak.
05-23-2150-0.1MG Ampulka plastikowa .1 mg
Description
OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
Catalogue Number05-23-2150
Brand Family Calbiochem®
SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
References
ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
Product Information
CAS number137061-48-4
ATP CompetitiveN
FormWhite to off-white solid
Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
Hygroscopic Hygroscopic
ReversibleN
Sold on the basis of peptide contentY
Quality LevelMQ100
Applications
Biological Information
Primary TargetAdenylate cyclase
Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
Purity≥96% by HPLC
Physicochemical Information
Cell permeableN
Peptide ContentY
Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Numer katalogowy GTIN
05-23-2150-0.1MG 04055977226652

Documentation

PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem MSDS

Title

Safety Data Sheet (SDS) 

PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificates of Analysis

TitleLot Number
05-23-2150

References

Przegląd literatury
Kobayashi, H., et al. 1994. Brain Res. 647, 145.
Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision12-May-2008 JSW
SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
FormWhite to off-white solid
CAS number137061-48-4
Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
Purity≥96% by HPLC
Solubility5% Acetic Acid (1 mg/ml)
Storage -20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Standard Handling
ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.