Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

374087 Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: Anti-HO-1, Anti-Hsp32

374087
Purchase on Sigma-Aldrich

Overview

Key Spec Table

Species ReactivityHostAntibody Type
B, Ca, H, Mk, M, RMMonoclonal Antibody

Products

Catalogue NumberPackaging Qty/Pack
374087-200UG Plastic ampoule 200 μg
Add To Favorites
Description
OverviewRecognizes the ~32 kDa HO-1 protein.
Catalogue Number374087
Brand Family Calbiochem®
SynonymsAnti-HO-1, Anti-Hsp32
Application Data
Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
References
ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J. 2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
Product Information
FormLiquid
FormulationIn PBS, 50% glycerol.
Preservative≤0.1% sodium azide
Quality LevelMQ100
Applications
Key Applications Immunoblotting (Western Blotting)
Immunocytochemistry
Immunoprecipitation
Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Biological Information
Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
ImmunogenHuman
CloneHO-1-1
HostMouse
IsotypeIgG₁
Species Reactivity
  • Bovine
  • Canine
  • Human
  • Monkey
  • Mouse
  • Rat
Antibody TypeMonoclonal Antibody
Concentration Label Please refer to vial label for lot-specific concentration
Storage and Shipping Information
Ship Code Blue Ice Only
Toxicity Standard Handling
Storage -20°C
Avoid freeze/thaw Avoid freeze/thaw
Do not freeze Ok to freeze
Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
Global Trade Item Number
Catalogue Number GTIN
374087-200UG 04055977191165