219483 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem
Synonyms: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
Recommended Products
Overview
| Replacement Information |
|---|
Key Spec Table
| Empirical Formula |
|---|
| C₂₂₈H₃₃₅N₆₁O₄₉S |
| Description | |
|---|---|
| Overview | This product has been discontinued. A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
| Catalogue Number | 219483 |
| Brand Family | Calbiochem® |
| Synonyms | AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY |
| References | |
|---|---|
| References | Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 219483 | 0 |
Documentation
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem SDS
| Title |
|---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem Certificates of Analysis
| Title | Lot Number |
|---|---|
| 219483 |
References
| Reference overview |
|---|
| Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |



