Millipore Sigma Vibrant Logo

196350 Bak BH3 Fusion Peptide, Cell-Permeable

A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.

Bak BH3 Fusion Peptide, Cell-Permeable MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3

Primary Target: Bcl-xL
196350
  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
—
Request Pricing
—
Limited Availability Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      Empirical Formula
      C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Description
      Overview

      This product has been discontinued.





      A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
      Catalogue Number196350
      Brand Family Calbiochem®
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      References
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Product Information
      ATP CompetitiveN
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Hygroscopic Hygroscopic
      ReversibleN
      Applications
      Biological Information
      Primary TargetBcl-xL
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      196350 0

      Documentation

      Bak BH3 Fusion Peptide, Cell-Permeable Certificates of Analysis

      TitleLot Number
      196350

      References

      Reference overview
      Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.

      Brochure

      Title
      Caspases and other Apoptosis Related Tools Brochure
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision17-April-2008 RFH
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      DescriptionA cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Purity≥95% by HPLC
      SolubilityDMSO (10 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Toxicity Standard Handling
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.