Millipore Sigma Vibrant Logo

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

Ficha de datos de seguridad (MSDS o SDS), certificado de análisis y de calidad (CoA y CoQ), expedientes, folletos y otros documentos disponibles.

Sinónimos: Ant-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)

Primary Target: Control for TIRAP inhibitor
View Products on Sigmaaldrich.com
613571
Ver precios y disponibilidad

Descripción

Tabla espec. clave

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Precios y disponibilidad

Número de referencia DisponiblidadEmbalaje Cant./Env. Precio Cantidad
613571-1MG
—
Disponibilidad a confirmar Disponibilidad a confirmar
Ingrese cantidad 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

      		 Ampolla de plást. 1 mg
      No pudo obtenerse el precio
      La cantidad mínima tiene que ser múltiplo de
      Maximum Quantity is
      Al finalizar el pedido Más información
      Ahorró ()
       
      —
      Solicitar precio
      		 —
      Añadir a favoritos
      Description
      OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      Catalogue Number613571
      Brand Family Calbiochem®
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      References
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Biological Information
      Primary TargetControl for TIRAP inhibitor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Global Trade Item Number
      Número de referencia GTIN
      613571-1MG 04055977263565