Millipore Sigma Vibrant Logo

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

Ficha de datos de seguridad (MSDS o SDS), certificado de análisis y de calidad (CoA y CoQ), expedientes, folletos y otros documentos disponibles.

Sinónimos: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Primary Target: Adenylate cyclase
View Products on Sigmaaldrich.com
05-23-2150
Ver precios y disponibilidad

Descripción

Replacement Information

Tabla espec. clave

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

Precios y disponibilidad

Número de referencia DisponiblidadEmbalaje Cant./Env. Precio Cantidad
US105232150-0.1MG
Comprobando disponibilidad...
—
Disponibilidad a confirmar Disponibilidad a confirmar
Ingrese cantidad 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

      		 Ampolla de plást. .1 mg
      Recuperando precio...
      No pudo obtenerse el precio
      La cantidad mínima tiene que ser múltiplo de
      Maximum Quantity is
      Al finalizar el pedido Más información
      Ahorró ()
       
      —
      Solicitar precio
      		 —
      Description
      OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
      Catalogue Number05-23-2150
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
      Product Information
      CAS number137061-48-4
      ATP CompetitiveN
      FormWhite to off-white solid
      Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetAdenylate cyclase
      Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
      Purity≥96% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Número de referencia GTIN
      US105232150-0.1MG 04055977226652

      Documentation

      PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Ficha datos de seguridad (MSDS)

      Título

      Ficha técnica de seguridad del material (MSDS) 

      PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Certificados de análisis

      CargoNúmero de lote
      05-23-2150

      Referencias bibliográficas

      Visión general referencias
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
      Ficha técnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-May-2008 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
      DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
      FormWhite to off-white solid
      CAS number137061-48-4
      Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
      Purity≥96% by HPLC
      Solubility5% Acetic Acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.