481418 Sigma-AldrichNEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem
Produits recommandés
Aperçu
Replacement Information |
---|
Tableau de caractéristiques principal
Empirical Formula |
---|
C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
References | |
---|---|
References | Chiaravalli, J., et al. 2011. Biochem. Pharm. 82, 1163. |
Product Information | |
---|---|
Form | White powder |
Hill Formula | C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
Chemical formula | C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥95% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | RQIKIWFQNRRMKWKKLKAQADIYKARFQAERHAREK |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Référence | GTIN |
481418 | 0 |
Documentation
NEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem FDS
Titre |
---|
NEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem Certificats d'analyse
Titre | Numéro de lot |
---|---|
481418 |
Références bibliographiques
Aperçu de la référence bibliographique |
---|
Chiaravalli, J., et al. 2011. Biochem. Pharm. 82, 1163. |