532385 Sigma-AldrichCaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem
Produits recommandés
Aperçu
Replacement Information |
---|
Prix & Disponibilité
Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
---|---|---|---|---|---|---|
5.32385.0001 |
|
Flacon en verre | 1 set |
|
— |
Product Information | |
---|---|
Form | Solid |
Formulation | Supplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt. |
Hygroscopic | Hygroscopic |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | CaMKII |
Primary Target IC<sub>50</sub> | ~5 µ |
Purity | ≥95% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | TATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Référence | GTIN |
5.32385.0001 | 04055977287233 |
Documentation
CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem FDS
Titre |
---|
Références bibliographiques
Aperçu de la référence bibliographique |
---|
Liu, X., et al. 2014. Neuropsychopharm. 29, 989. Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188. Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599. Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024. |
Informations techniques
Titre |
---|
White Paper: Further considerations of antibody validation and usage. |