Millipore Sigma Vibrant Logo

05-23-0930 β-Endorphin, Human

β-Endorphin, Human : FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: β-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

05-23-0930
  
Prix en cours de récupération
Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
Maximum Quantity is
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
 
—
Demander le prix
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

       

      Contacter le Service Clients

      Aperçu

      Replacement Information

      Tableau de caractéristiques principal

      CAS #Empirical Formula
      61214-51-5C₁₅₈H₂₅₁N₃₉O₄₆S
      Description
      Overview

      This product has been discontinued.

      We apologize for the inconvenience, but we do not currently have an alternative product.





      Neurohormone secreted by the pituitary gland. The most potent of the opioid peptides. More effective than morphine in tests of opioid receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      Catalogue Number05-23-0930
      Brand Family Calbiochem®
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      References
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Product Information
      CAS number61214-51-5
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Applications
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      RTECSJZ1650000
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Protect from Moisture Protect from moisture
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Référence GTIN
      05-23-0930 0

      Documentation

      β-Endorphin, Human Certificats d'analyse

      TitreNuméro de lot
      05-23-0930

      Références bibliographiques

      Aperçu de la référence bibliographique
      Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.
      Fiche technique

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      Synonymsβ-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
      DescriptionNeurohormone secreted by the pituitary gland. The most potent of the opiate peptides. More effective than morphine in tests of opiate receptor binding, analgesia, and catatonia. High doses cause rigidity and hypothermia in rats.
      FormWhite to off-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number61214-51-5
      RTECSJZ1650000
      Chemical formulaC₁₅₈H₂₅₁N₃₉O₄₆S
      Peptide SequenceH-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH
      Purity≥95% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage Protect from moisture
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      Merck USA index14, 3572
      ReferencesDalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311.
      Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223.