Millipore Sigma Vibrant Logo

532385 CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem

532385
View Pricing & Availability

Overview

Replacement Information

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
5.32385.0001
Retrieving availability...
Fulfillment and Delivery Delayed
Fulfillment and Delivery Delayed
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Glass bottle 1 set
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      Description
      OverviewA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both α and β isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
      Catalogue Number532385
      Brand Family Calbiochem®
      Synonymstat-fused CN21
      References
      ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
      Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
      Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
      Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.
      Product Information
      FormSolid
      FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
      Hygroscopic Hygroscopic
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetCaMKII
      Primary Target IC<sub>50</sub>~5 µ
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
      TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Shipped at Ambient Temperature or with Blue Ice or with Dry Ice
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      5.32385.0001 04055977287233

      Documentation

      CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      References

      Reference overview
      Liu, X., et al. 2014. Neuropsychopharm. 29, 989.
      Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
      Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
      Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.

      Technical Info

      Title
      White Paper: Further considerations of antibody validation and usage.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision28-January-2015 JSW
      Synonymstat-fused CN21
      DescriptionA cell permeable TAT sequence fused with a 21 amino acid peptide derived from the naturally occurring inhibitor protein CaM-KIIN (a.a.43-63; KRPPKLGQIGRSKRVVIEDDR). Acts as a selective, reversible, T-site targeting, inhibitor of CaM Kinase II (~ 5 µM). Effectively blocks CaM kinase II autophophorylation on Thr305/306, however, its effect on Thr286 phosphorylation is not significant. Inhibits both a and b isoforms of CaM kinase II and is shown to block autonomous and stimulated CaM kinase II activities with equal potency. Does not affect the activity of CaM kinase I, protein kinase A, and protein kinase C, however, at 5 µM it has a very mild effect on CaM Kinase IV. Blocks NMDA-induced translocation of CaM kinase II to post-synaptic densities and also inhibits binding of CaM kinase II to NR2B (~1 µM). Shown to reverse long-term potentiation and reduce basal synaptic strength (~ 20 µM). Its inhibitory effects are largely restricted to dendrites, with minimal effect in the soma. The control peptide included in this set contains the TAT sequence fused to a scrambled sequence (VKEPRIDGKPVRLRGQKSDRI).
      FormSolid
      FormulationSupplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Peptide SequenceTATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
      TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI
      Purity≥95% by HPLC
      SolubilityH₂O (50 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up 6 months at -20°C.
      Toxicity Standard Handling
      ReferencesLiu, X., et al. 2014. Neuropsychopharm. 29, 989.
      Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188.
      Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599.
      Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024.