Millipore Sigma Vibrant Logo

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

SDB (Sicherheitsdatenblätter), Analysenzertifikate und Qualitätszertifikate, Dossiers, Broschüren und andere verfügbare Dokumente.

Synonyme: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Primary Target: Adenylate cyclase
View Products on Sigmaaldrich.com
05-23-2150
Preis & Verfügbarkeit

Übersicht

Replacement Information

Key Spec Table

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

Preis & Verfügbarkeit

Bestellnummer VerfügbarkeitVerpackung St./Pkg. Preis Menge
05-23-2150-0.1MG
Verfügbarkeit wird abgerufen...
—
Eingeschränkte Verfügbarkeit Eingeschränkte Verfügbarkeit
Lieferbar 
Produkt wurde eingestellt
Begrenzter Lagerbestand
Bestätigung der Verfügbarkeit erforderlich
    Restmenge: Angebot folgt
      Restmenge: Angebot folgt
      Bitte erfragen
      Kontakt zum Kundenservice
      Contact Customer Service

      		 Kst.-Ampulle .1 mg
      Preis wird abgerufen...
      Preis nicht abrufbar
      Die Mindestmenge muss ein Vielfaches sein von
      Maximum Quantity is
      Bei Bestätigung Weitere Informationen
      Sie haben () gespart
       
      —
      Bitte erfragen
      		 —
      Description
      OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
      Catalogue Number05-23-2150
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
      Product Information
      CAS number137061-48-4
      ATP CompetitiveN
      FormWhite to off-white solid
      Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetAdenylate cyclase
      Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
      Purity≥96% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Bestellnummer GTIN
      05-23-2150-0.1MG 04055977226652

      Documentation

      PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem SDB

      Titel

      Sicherheitsdatenblatt (SDB) 

      PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem Analysenzertifikate

      TitelChargennummer
      05-23-2150

      Literatur

      Übersicht
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
      Datenblatt

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-May-2008 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
      DescriptionMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
      FormWhite to off-white solid
      CAS number137061-48-4
      Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
      Purity≥96% by HPLC
      Solubility5% Acetic Acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
      Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
      Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.