Millipore Sigma Vibrant Logo

219483 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem

FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY

Primary Target: Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
View Products on Sigmaaldrich.com
219483
  
Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
Maximum Quantity is
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
 
—
Demander le prix
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

       

      Contacter le Service Clients

      Aperçu

      Tableau de caractéristiques principal

      Empirical Formula
      C₂₂₈H₃₃₅N₆₁O₄₉S
      Description
      Overview

      This product has been discontinued.



      A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
      Catalogue Number219483
      Brand Family Calbiochem®
      SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
      References
      ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Biological Information
      Primary TargetNegative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
      Storage and Shipping Information
      Ship Code Shipped with Blue Ice or with Dry Ice
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Global Trade Item Number
      Référence GTIN
      219483 0