Millipore Sigma Vibrant Logo

05-23-2405 Calcitonin Gene-Related Peptide-II, Human

Calcitonin Gene-Related Peptide-II, Human : FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: CGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂

05-23-2405
  
Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
Maximum Quantity is
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
 
—
Demander le prix
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

       

      Contacter le Service Clients

      Aperçu

      Tableau de caractéristiques principal

      CAS #Empirical Formula
      98824-26-1C₁₆₂H₂₆₇N₅₁O₄₈S₃
      Description
      OverviewPotent hypotensive agent and vasodilator.
      Catalogue Number05-23-2405
      Brand Family Calbiochem®
      SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
      References
      ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
      Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
      Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
      Product Information
      CAS number98824-26-1
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
      Global Trade Item Number
      Référence GTIN
      05-23-2405 0