Millipore Sigma Vibrant Logo

196350 Bak BH3 Fusion Peptide, Cell-Permeable

A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.

Bak BH3 Fusion Peptide, Cell-Permeable : FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3

Primary Target: Bcl-xL
196350
  
Prix en cours de récupération
Le prix n'a pas pu être récupéré
La quantité minimale doit être un multiple de
Maximum Quantity is
À la validation de la commande Plus d'informations
Vous avez sauvegardé ()
 
—
Demander le prix
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

       

      Contacter le Service Clients

      Aperçu

      Replacement Information

      Tableau de caractéristiques principal

      Empirical Formula
      C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Description
      Overview

      This product has been discontinued.





      A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
      Catalogue Number196350
      Brand Family Calbiochem®
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      References
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Product Information
      ATP CompetitiveN
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Hygroscopic Hygroscopic
      ReversibleN
      Applications
      Biological Information
      Primary TargetBcl-xL
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Référence GTIN
      196350 0

      Documentation

      Bak BH3 Fusion Peptide, Cell-Permeable Certificats d'analyse

      TitreNuméro de lot
      196350

      Références bibliographiques

      Aperçu de la référence bibliographique
      Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.

      Brochure

      Titre
      Caspases and other Apoptosis Related Tools Brochure
      Fiche technique

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision17-April-2008 RFH
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      DescriptionA cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Purity≥95% by HPLC
      SolubilityDMSO (10 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Toxicity Standard Handling
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.