219482 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
More>> Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. Less<<Sinónimos: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
Productos recomendados
Descripción
Replacement Information |
---|
Tabla espec. clave
Empirical Formula |
---|
C₂₂₈H₃₃₅N₆₁O₄₉S |
Precios y disponibilidad
Número de referencia | Disponiblidad | Embalaje | Cant./Env. | Precio | Cantidad | |
---|---|---|---|---|---|---|
219482-1MG |
|
Ampolla de plást. | 1 mg |
|
— |
Product Information | |
---|---|
ATP Competitive | N |
Form | White lyophilized solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Hygroscopic | Hygroscopic |
Reversible | N |
Quality Level | MQ100 |
Applications | |
---|---|
Application | Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. |
Biological Information | |
---|---|
Primary Target | eNOS |
Purity | ≥95% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Número de referencia | GTIN |
219482-1MG | 04055977218565 |
Documentation
Licencias necesarias
Título |
---|
PRODUCTO REGULADO POR LA SECRETARÍA DE SALUD |
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Ficha datos de seguridad (MSDS)
Título |
---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificados de análisis
Cargo | Número de lote |
---|---|
219482 |
Referencias bibliográficas
Visión general referencias |
---|
Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761. Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630. Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Liu, J., et al. 2002. J. Biol. Chem. 277, 10661. Bucci, M., et al. 2000. Nat. Med. 6, 1362. Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419. |