Millipore Sigma Vibrant Logo

196350 Bak BH3 Fusion Peptide, Cell-Permeable

A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.

Bak BH3 Fusion Peptide, Cell-Permeable: Ficha de datos de seguridad (MSDS o SDS), certificado de análisis y de calidad (CoA y CoQ), expedientes, folletos y otros documentos disponibles.

Sinónimos: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3

Primary Target: Bcl-xL
196350
  
Recuperando precio...
No pudo obtenerse el precio
La cantidad mínima tiene que ser múltiplo de
Maximum Quantity is
Al finalizar el pedido Más información
Ahorró ()
 
—
Solicitar precio
—
Disponibilidad a confirmar Disponibilidad a confirmar
Ingrese cantidad 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

       

      Póngase en contacto con el Servicio de Atención al Cliente

      Descripción

      Replacement Information

      Tabla espec. clave

      Empirical Formula
      C₁₉₆H₃₂₁N₆₅O₄₇S₂
      Description
      Overview

      This product has been discontinued.





      A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
      Catalogue Number196350
      Brand Family Calbiochem®
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      References
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
      Product Information
      ATP CompetitiveN
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Hygroscopic Hygroscopic
      ReversibleN
      Applications
      Biological Information
      Primary TargetBcl-xL
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Número de referencia GTIN
      196350 0

      Documentation

      Bak BH3 Fusion Peptide, Cell-Permeable Certificados de análisis

      CargoNúmero de lote
      196350

      Referencias bibliográficas

      Visión general referencias
      Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.

      Folleto

      Cargo
      Caspases and other Apoptosis Related Tools Brochure
      Ficha técnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision17-April-2008 RFH
      SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
      DescriptionA cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
      FormOff-white lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
      Purity≥95% by HPLC
      SolubilityDMSO (10 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
      Toxicity Standard Handling
      ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
      Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.