Millipore Sigma Vibrant Logo

374087 Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

Descripción

Tabla espec. clave

Species ReactivityHostAntibody Type
B, Ca, H, Mk, M, RMMonoclonal Antibody

Precios y disponibilidad

Número de referencia DisponiblidadEmbalaje Cant./Env. Precio Cantidad
374087-200UG
Disponibilidad a confirmar
Disponibilidad a confirmar
Ingrese cantidad 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

      Ampolla de plást. 200 μg
      No pudo obtenerse el precio
      La cantidad mínima tiene que ser múltiplo de
      Maximum Quantity is
      Al finalizar el pedido Más información
      Ahorró ()
       
      Solicitar precio
      Description
      OverviewRecognizes the ~32 kDa HO-1 protein.
      Catalogue Number374087
      Brand Family Calbiochem®
      SynonymsAnti-HO-1, Anti-Hsp32
      Application Data
      Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

      Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
      References
      ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
      Maines, M.D. 1988. FASEB J. 2, 2557.
      Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
      Product Information
      FormLiquid
      FormulationIn PBS, 50% glycerol.
      Preservative≤0.1% sodium azide
      Quality LevelMQ100
      Applications
      Key Applications Immunoblotting (Western Blotting)
      Immunocytochemistry
      Immunoprecipitation
      Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
      Immunocytochemistry (1:1000)
      Immunoprecipitation (20 µg/ml)
      Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
      Biological Information
      Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
      ImmunogenHuman
      CloneHO-1-1
      HostMouse
      IsotypeIgG₁
      Species Reactivity
      • Bovine
      • Canine
      • Human
      • Monkey
      • Mouse
      • Rat
      Antibody TypeMonoclonal Antibody
      Concentration Label Please refer to vial label for lot-specific concentration
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Avoid freeze/thaw Avoid freeze/thaw
      Do not freeze Ok to freeze
      Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
      Global Trade Item Number
      Número de referencia GTIN
      374087-200UG 04055977191165