Millipore Sigma Vibrant Logo

171596 β-Amyloid Peptide (1-42), Rat

Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

β-Amyloid Peptide (1-42), Rat: Ficha de datos de seguridad (MSDS o SDS), certificado de análisis y de calidad (CoA y CoQ), expedientes, folletos y otros documentos disponibles.

Sinónimos: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

View Products on Sigmaaldrich.com
171596
Ver precios y disponibilidad

Descripción

Replacement Information

Precios y disponibilidad

Número de referencia DisponiblidadEmbalaje Cant./Env. Precio Cantidad
171596-250UG
Comprobando disponibilidad...
—
Disponibilidad a confirmar Disponibilidad a confirmar
Ingrese cantidad 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

      		 Ampolla de plást. 250 μg
      Recuperando precio...
      No pudo obtenerse el precio
      La cantidad mínima tiene que ser múltiplo de
      Maximum Quantity is
      Al finalizar el pedido Más información
      Ahorró ()
       
      —
      Solicitar precio
      		 —
      Description
      OverviewPredominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
      Catalogue Number171596
      Brand Family Calbiochem®
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      References
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.
      Product Information
      CAS number107761-42-2
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Hygroscopic Hygroscopic
      Quality LevelMQ100
      Applications
      Biological Information
      Purity≥80% by HPLC
      Physicochemical Information
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Número de referencia GTIN
      171596-250UG 04055977207286

      Documentation

      Licencias necesarias

      Título
      PRODUCTO REGULADO POR LA SECRETARÍA DE SALUD

      β-Amyloid Peptide (1-42), Rat Ficha datos de seguridad (MSDS)

      Título

      Ficha técnica de seguridad del material (MSDS) 

      β-Amyloid Peptide (1-42), Rat Certificados de análisis

      CargoNúmero de lote
      171596

      Referencias bibliográficas

      Visión general referencias
      Paradis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.

      Folleto

      Cargo
      Alzheimer's Disease Brochure & Technical Guide
      Ficha técnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision14-April-2008 RFH
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      Descriptionβ-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer's diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      CAS number107761-42-2
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Purity≥80% by HPLC
      Solubility5% Acetic Acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.