Millipore Sigma Vibrant Logo

05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂

Primary Target: Increases cAMP levels
View Products on Sigmaaldrich.com
05-23-2151
View Pricing & Availability

Overview

Replacement Information

Key Spec Table

CAS #Empirical Formula
127317-03-7C₁₄₂H₂₂₄N₄₀O₃₉S

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
05-23-2151-0.5MG
Retrieving availability...
—
Limited Availability Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      		 Glass bottle .5 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      —
      Request Pricing
      		 —
      Description
      OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      Catalogue Number05-23-2151
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Product Information
      CAS number127317-03-7
      ATP CompetitiveN
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetIncreases cAMP levels
      Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      05-23-2151-0.5MG 04055977226676

      Documentation

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Certificates of Analysis

      TitleLot Number
      05-23-2151

      References

      Reference overview
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-September-2022 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number127317-03-7
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.