Millipore Sigma Vibrant Logo

05-23-2405 Calcitonin Gene-Related Peptide-II, Human

Calcitonin Gene-Related Peptide-II, Human MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: CGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂

05-23-2405
  
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
—
Request Pricing
—
Limited Availability Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Key Spec Table

      CAS #Empirical Formula
      98824-26-1C₁₆₂H₂₆₇N₅₁O₄₈S₃
      Description
      OverviewPotent hypotensive agent and vasodilator.
      Catalogue Number05-23-2405
      Brand Family Calbiochem®
      SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
      References
      ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
      Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
      Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
      Product Information
      CAS number98824-26-1
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
      Global Trade Item Number
      Catalogue Number GTIN
      05-23-2405 0