05-23-2005 Sigma-AldrichNeuropeptide Y, Human - CAS 90880-35-6 - Calbiochem
A potent vasoconstrictor.
More>> A potent vasoconstrictor. Less<<Synonyms: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
Recommended Products
Overview
Replacement Information |
---|
Key Spec Table
CAS # | Empirical Formula |
---|---|
90880-35-6 | C₁₈₉H₂₈₅N₅₅O₅₇S |
Products
Catalogue Number | Packaging | Qty/Pack | |
---|---|---|---|
US105232005-0.5MG | Glass bottle | .5 mg | |
05-23-2005-1MG | Plastic ampoule | 1 mg |
References | |
---|---|
References | Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |
Product Information | |
---|---|
CAS number | 90880-35-6 |
ATP Competitive | N |
Form | White to off-white lyophilized solid |
Formulation | Supplied as trifluoroacetate salt. Sold on the basis of peptide content. |
Hill Formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
Chemical formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
Reversible | Y |
Sold on the basis of peptide content | Y |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | A potent vasoconstrictor |
Purity | ≥97% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information | |
---|---|
R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
S Phrase | S: 36 Wear suitable protective clothing. |
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalogue Number | GTIN |
US105232005-0.5MG | 04055977206371 |
05-23-2005-1MG | 04055977206388 |
Documentation
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem SDS
Title |
---|
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificates of Analysis
Title | Lot Number |
---|---|
05-23-2005 |
References
Reference overview |
---|
Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |