Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

05-23-2405 Calcitonin Gene-Related Peptide-II, Human

05-23-2405
  
Purchase on Sigma-Aldrich

Áttekintés

Replacement Information

Kulcsspecifikációk táblázata

CAS #Empirical Formula
98824-26-1C₁₆₂H₂₆₇N₅₁O₄₈S₃
Description
OverviewPotent hypotensive agent and vasodilator.
Catalogue Number05-23-2405
Brand Family Calbiochem®
SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
References
ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
Product Information
CAS number98824-26-1
FormWhite to off-white solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
Hygroscopic Hygroscopic
Sold on the basis of peptide contentY
Applications
Biological Information
Purity≥95% by HPLC
Physicochemical Information
Peptide ContentY
Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
R PhraseR: 20/21/22

Harmful by inhalation, in contact with skin and if swallowed.
S PhraseS: 36

Wear suitable protective clothing.
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Harmful
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Katalógusszám GTIN
05-23-2405 0

Documentation

Calcitonin Gene-Related Peptide-II, Human Certificates of Analysis

TitleLot Number
05-23-2405

References

Hivatkozások áttekintése
Henke, H., et al. 1987. Brain Res. 410, 404.
Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision18-September-2008 RFH
SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
DescriptionPotent hypotensive agent and vasodilator.
FormWhite to off-white solid
FormulationSupplied as a trifluoroacetate salt.
CAS number98824-26-1
Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
Purity≥95% by HPLC
Solubility5% Acetic Acid (1 mg/ml) or H₂O (1 mg/ml)
Storage -20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
Toxicity Harmful
ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.