Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

06-579 Anti-Gab1 Antibody, CT

06-579
200 µg  
Purchase on Sigma-Aldrich

Különleges ajánlatok

Áttekintés

Replacement Information

Különleges ajánlatok

Kulcsspecifikációk táblázata

Species ReactivityKey ApplicationsHostFormatAntibody Type
H, M, RICC, IH(P), IP, WBRbAffinity PurifiedPolyclonal Antibody
Description
Catalogue Number06-579
Brand Family Upstate
Trade Name
  • Upstate
DescriptionAnti-Gab1 Antibody, CT
Alternate Names
  • GRB2-associated binder
  • GRB2-associated binding protein
  • Growth factor receptor bound protein 2-associated protein
Background InformationGab1 is a 115 kDa multiple docking protein that plays an essential role in cellular growth, transformation and apoptosis. Gab1 can be phosphorylated by multiple receptor tyrosine kinase (RTKs), including: insulin receptor (IR), platelet derived growth factor receptor beta] (PDGFR-β]), hepatocyte growth factor/scatter factor receptor (HGFR/SFR or c Met), and epidermal growth factor receptor (EGF), as well as in response to cell cell adhesion. Gab1 is tyrosine phosphorylated on at least 16 sites, some of which serve as binding sites for phosphoatidylinositol 3 kinase (PI3K), Grb2, PLC gamma 1, Nck, and SHP2. Phosphorylation of Gab1 on tyrosines 627 and 659 is critical for its binding to SHP2, and for activation of the ERK/MAPK pathway in response to EGF.
References
Product Information
FormatAffinity Purified
Control
  • Non-stimulated A431 carcinoma cell lysate or NIH/3T3 cytoplasmic lysate.
PresentationAffinity purified IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen solution.
Quality LevelMQ100
Applications
ApplicationAnti-Gab1 Antibody, CT detects level of Gab1 & has been published & validated for use in IC, IH(P), IP & WB.
Key Applications
  • Immunocytochemistry
  • Immunohistochemistry (Paraffin)
  • Immunoprecipitation
  • Western Blotting
Application NotesImmunoprecipitation:
4 μg of this lot immunoprecipitated Gab1 from 500 μg of a human A431 carcinoma cell RIPA lysate.

Immunocytochemistry:
10 μg/mL of a previous lot showed positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.
Biological Information
Immunogen31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1 (CQKTLALKSTREAWTDGRQSTESETPAKSVK).
EpitopeC-terminus
ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
HostRabbit
SpecificitySpecific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence.
IsotypeIgG
Species Reactivity
  • Human
  • Mouse
  • Rat
Species Reactivity NoteHuman, mouse and rat. Reactivity with other species has not been confirmed.
Antibody TypePolyclonal Antibody
Entrez Gene Number
Entrez Gene SummaryThe protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. The encoded protein is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol
  • GAB1
Purification MethodAffinity Purfied
UniProt Number
UniProt SummaryFUNCTION: SwissProt: Q13480 # Probably involved in EGF and insulin receptor signaling.
SIZE: 694 amino acids; 76616 Da
SUBUNIT: Interacts with GRB2 and with other SH2-containing proteins. Interacts with phosphorylated LAT2.
PTM: Phosphorylated on tyrosine residue(s) by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Tyrosine phosphorylation of GAB1 mediates interaction with several proteins that contain SH2 domains.
SIMILARITY: SwissProt: Q13480 ## Belongs to the GAB family. & Contains 1 PH domain.
Molecular Weight115 kDa
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Quality AssuranceRoutinely evaluated by Western Blot on RIPA lysates from human A431 carcinoma cells.

Western Blot Analysis:
0.5-2 μg/mL of this lot detected Gab1 in RIPA lysates from human A431 carcinoma cells.
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStable for 1 year at -20ºC from date of receipt.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.
Packaging Information
Material Size200 µg
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Katalógusszám GTIN
06-579 04053252672194

Documentation

Anti-Gab1 Antibody, CT MSDS

Title

Safety Data Sheet (SDS) 

Anti-Gab1 Antibody, CT Certificates of Analysis

TitleLot Number
Anti-Gab1, CT 2470868
Anti-Gab1, CT - 2453201 2453201
Anti-Gab1, CT - 16510 16510
Anti-Gab1, CT - 17382 17382
Anti-Gab1, CT - 18848 18848
Anti-Gab1, CT - 19913 19913
Anti-Gab1, CT - 1993920 1993920
Anti-Gab1, CT - 2200928 2200928
Anti-Gab1, CT - 22981 22981
Anti-Gab1, CT - 2344666 2344666

References

Reference overviewApplicationSpeciesPub Med ID
Diminished functional role and altered localization of SHP2 in non-small cell lung cancer cells with EGFR-activating mutations.
Furcht, CM; Muñoz Rojas, AR; Nihalani, D; Lazzara, MJ
Oncogene  32  2346-55, 2355.e1-10  2013

Kivonat megmutatása
22777356 22777356
JAK2-V617F-induced MAPK activity is regulated by PI3K and acts synergistically with PI3K on the proliferation of JAK2-V617F-positive cells.
Wolf, A; Eulenfeld, R; Gäbler, K; Rolvering, C; Haan, S; Behrmann, I; Denecke, B; Haan, C; Schaper, F
JAK-STAT  2  e24574  2013

Kivonat megmutatása
24069558 24069558
Combined drug action of 2-phenylimidazo[2,1-b]benzothiazole derivatives on cancer cells according to their oncogenic molecular signatures.
Furlan, Alessandro, et al.
PLoS ONE, 7: e46738 (2012)  2011

Kivonat megmutatása
23071625 23071625
The angiotensin IV analog Nle-Tyr-Leu-psi-(CH2-NH2)3-4-His-Pro-Phe (norleual) can act as a hepatocyte growth factor/c-Met inhibitor.
Yamamoto, BJ; Elias, PD; Masino, JA; Hudson, BD; McCoy, AT; Anderson, ZJ; Varnum, MD; Sardinia, MF; Wright, JW; Harding, JW
The Journal of pharmacology and experimental therapeutics  333  161-73  2009

Kivonat megmutatása Teljes cikk
20086056 20086056
Interaction between simian virus 40 large T antigen and insulin receptor substrate 1 is disrupted by the K1 mutation, resulting in the loss of large T antigen-mediated phosphorylation of Akt.
Yu, Y; Alwine, JC
Journal of virology  82  4521-6  2008

Kivonat megmutatása
18305032 18305032
Transforming signals resulting from sustained activation of the PDGFbeta receptor in mortal human fibroblasts.
Petti, Lisa M, et al.
J. Cell. Sci., 121: 1172-82 (2008)  2008

Kivonat megmutatása
Human18349076 18349076
Coupling of Grb2 to Gab1 mediates hepatocyte growth factor-induced high intensity ERK signal required for inhibition of HepG2 hepatoma cell proliferation.
Kondo, A; Hirayama, N; Sugito, Y; Shono, M; Tanaka, T; Kitamura, N
The Journal of biological chemistry  283  1428-36  2008

Kivonat megmutatása
18003605 18003605
Distinct requirements for Gab1 in Met and EGF receptor signaling in vivo.
Schaeper, U; Vogel, R; Chmielowiec, J; Huelsken, J; Rosario, M; Birchmeier, W
Proceedings of the National Academy of Sciences of the United States of America  104  15376-81  2007

Kivonat megmutatása Teljes cikk
17881575 17881575
Host adaptor proteins Gab1 and CrkII promote InlB-dependent entry of Listeria monocytogenes.
Hong Sun,Yang Shen,Hatem Dokainish,Marina Holgado-Madruga,Albert Wong,Keith Ireton
Cellular microbiology  7  2004

Kivonat megmutatása
15679846 15679846
Redundant roles for Met docking site tyrosines and the Gab1 pleckstrin homology domain in InlB-mediated entry of Listeria monocytogenes.
Basar, T; Shen, Y; Ireton, K
Infection and immunity  73  2061-74  2004

Kivonat megmutatása Teljes cikk
15784547 15784547