05-23-2005 Sigma-AldrichNeuropeptide Y, Human - CAS 90880-35-6 - Calbiochem
A potent vasoconstrictor.
More>> A potent vasoconstrictor. Less<<Synonymes: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
Produits recommandés
Aperçu
| Replacement Information |
|---|
Tableau de caractéristiques principal
| CAS # | Empirical Formula |
|---|---|
| 90880-35-6 | C₁₈₉H₂₈₅N₅₅O₅₇S |
Prix & Disponibilité
| Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
|---|---|---|---|---|---|---|
| 05-23-2005-0.5MG |
|
Flacon en verre | .5 mg |
|
— | |
| 05-23-2005-1MG |
|
Ampoule plast. | 1 mg |
|
— |
| References | |
|---|---|
| References | Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |
| Product Information | |
|---|---|
| CAS number | 90880-35-6 |
| ATP Competitive | N |
| Form | White to off-white lyophilized solid |
| Formulation | Supplied as trifluoroacetate salt. Sold on the basis of peptide content. |
| Hill Formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
| Chemical formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
| Reversible | Y |
| Sold on the basis of peptide content | Y |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | A potent vasoconstrictor |
| Purity | ≥97% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information | |
|---|---|
| R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
| S Phrase | S: 36 Wear suitable protective clothing. |
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Référence | GTIN |
| 05-23-2005-0.5MG | 04055977206371 |
| 05-23-2005-1MG | 04055977206388 |
Documentation
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem FDS
| Titre |
|---|
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificats d'analyse
| Titre | Numéro de lot |
|---|---|
| 05-23-2005 |
Références bibliographiques
| Aperçu de la référence bibliographique |
|---|
| Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |



