Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

06-847-25UG Anti-EGFR (rabbit polyclonal IgG)

Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.

Anti-EGFR (rabbit polyclonal IgG) MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Research Category: Signaling Research Sub-Category: Growth Factors & Receptors Gene Symbol: EGFR, ERBB1, ERBB, mENA UniProt Number: P00533
06-847-25UG
25 μg  
Purchase on Sigma-Aldrich

Special Offers

Overview

Replacement Information

Special Offers

100% Performance Guaranteed

Key Spec Table

Species ReactivityKey ApplicationsHostFormatAntibody Type
H, M, R, HtIP, WBRbPurifiedPolyclonal Antibody
Description
Catalogue Number06-847-25UG
Brand Family Upstate
Trade Name
  • Upstate
DescriptionAnti-EGFR (rabbit polyclonal IgG)
Alternate Names
  • Receptor tyrosine-protein kinase ErbB-1
  • avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
  • cell growth inhibiting protein 40
  • cell proliferation-inducing protein 61
  • epidermal growth factor receptor
  • epidermal growth factor receptor (avian erythroblastic leukemia viral
    (v-erb-b) oncogene homolog)
  • epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Background InformationThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
References
Product Information
FormatPurified
Control
  • A431 cell lysate, human cervical carcinoma.

    Included Positive Antigen Control:
    Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.
PresentationPurified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
Quality LevelMQ100
Applications
ApplicationAnti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
Key Applications
  • Immunoprecipitation
  • Western Blotting
Application NotesImmunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 dilution of this antibody detected EGFR in human placenta tissue sections.
Biological Information
ImmunogenOvalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.
ConcentrationPlease refer to lot specific datasheet.
HostRabbit
SpecificityRecognizes the EGFR, Mr 180 kDa.
IsotypeIgG
Species Reactivity
  • Human
  • Mouse
  • Rat
  • Hamster
Species Reactivity NoteMouse and human. Reported to detect rat and hamster.
Antibody TypePolyclonal Antibody
Entrez Gene Number
Entrez Gene SummaryThe protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq]
Gene Symbol
  • EGFR
  • ERBB1
  • ERBB
  • mENA
Purification MethodProtein A chromatography
UniProt Number
UniProt SummaryFUNCTION: SwissProt: P00533 # Isoform 2/truncated isoform may act as an antagonist.
SIZE: 1210 amino acids; 134277 Da
SUBUNIT: Binds RIPK1. CBL interacts with the autophosphorylated C- terminal tail of the EGF receptor. Part of a complex with ERBB2 and either PIK3C2A or PIK3C2B. The autophosphorylated form interacts with PIK3C2B, maybe indirectly. Interacts with PELP1.
SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. & Isoform 2: Secreted.
TISSUE SPECIFICITY: Expressed in placenta. Isoform 2 is also expressed in ovarian cancers.
PTM: Phosphorylation of Ser-695 is partial and occurs only if Thr- 693 is phosphorylated. & Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through 'Lys-63', but linkage through 'Lys-48', 'Lys-11' and 'Lys-29' also occur.DISEASE:SwissProt: P00533 # Defects in EGFR are associated with lung cancer [MIM:211980].
SIMILARITY: SwissProt: P00533 ## Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. & Contains 1 protein kinase domain.
MISCELLANEOUS: Binding of EGF to the receptor leads to dimerization, internalization of the EGF-receptor complex, induction of the tyrosine kinase activity, stimulation of cell DNA synthesis, and cell proliferation.
Molecular Weight180 kDa
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Quality AssuranceRoutinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.
Packaging Information
Material Size25 μg
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
06-847-25UG 04054839337475