Millipore Sigma Vibrant Logo
Atención: Nos hemos mudado. Los productos Merck Millipore ya no pueden adquirirse en MerckMillipore.comMás información

374090 Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

374090
Purchase on Sigma-Aldrich

Descripción

Replacement Information

Tabla espec. clave

Species ReactivityHostAntibody Type
Ca, Ht, H, Mk, M, RRbPolyclonal Antibody

Products

Número de referenciaEmbalaje Cant./Env.
374090-100UL Ampolla de plást. 100 ul
Description
OverviewRecognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.
Catalogue Number374090
Brand Family Calbiochem®
SynonymsAnti-HO-1, Anti-Hsp32
Application Data
Detection of heme oxygenase-1 by immunoblotting. Samples: Recombinant rat HO-1 (lane 1), recombinant human HO-1 (lane 2), negative control recombinant human protein (lane 3), extracts from dog liver microsomes (lane 4), mouse liver microsomes (lane 5), rat liver microsomes (lane 6), and human liver microsomes (lane 7). Primary antibody: Anti-Heme Oxygenase-1 (1-30) Rabbit pAb (Cat. No. 374090) (1:1000). Detection: chemiluminescence.
References
ReferencesMaines, M.D. 1988 FASEB J. 2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
Product Information
FormLiquid
FormulationIn PBS, 50% glycerol, pH 7.2.
Preservative≤0.1% sodium azide
Quality LevelMQ100
Applications
Key Applications Immunoblotting (Western Blotting)
Immunoprecipitation
Application NotesImmunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100)
Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Biological Information
Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
ImmunogenHuman
HostRabbit
IsotypeIgG
Species Reactivity
  • Canine
  • Hamster
  • Human
  • Monkey
  • Mouse
  • Rat
Antibody TypePolyclonal Antibody
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
S PhraseS: 24/25-36-A09

Avoid contact with skin and eyes.
Wear suitable protective clothing.
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Avoid freeze/thaw Avoid freeze/thaw
Do not freeze Ok to freeze
Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Número de referencia GTIN
374090-100UL 04055977191172

Documentation

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb Ficha datos de seguridad (MSDS)

Título

Ficha técnica de seguridad del material (MSDS) 

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb Certificados de análisis

CargoNúmero de lote
374090

Referencias bibliográficas

Visión general referencias
Maines, M.D. 1988 FASEB J. 2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
Ficha técnica

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision15-December-2008 JSW
SynonymsAnti-HO-1, Anti-Hsp32
ApplicationImmunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100)
Application Data
Detection of heme oxygenase-1 by immunoblotting. Samples: Recombinant rat HO-1 (lane 1), recombinant human HO-1 (lane 2), negative control recombinant human protein (lane 3), extracts from dog liver microsomes (lane 4), mouse liver microsomes (lane 5), rat liver microsomes (lane 6), and human liver microsomes (lane 7). Primary antibody: Anti-Heme Oxygenase-1 (1-30) Rabbit pAb (Cat. No. 374090) (1:1000). Detection: chemiluminescence.
DescriptionProtein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
BackgroundHeme oxygenase (HO) is a microsomal enzyme that oxidatively cleaves heme, a pro-oxidant, into carbon monoxide and biliverdin, which is reduced to the antioxidant, bilirubin. Two isozymes, termed HO-1 and HO-2, have been identified. By SDS-PAGE, mammalian HO-1 is ~31-33 kDa; HO-2 is ~36 kDa. HO-1, also referred to as stress protein Hsp32, is the inducible form of the enzyme. HO-1 expression can be induced by a variety of stimuli such as heme, metals, hormones, UV radiation and sulfhydryl depleting agents. In contrast, HO-2 is constitutively expressed. HO-2 is the most prevalent form in most tissues, except the spleen where HO-1 levels are predominant.
HostRabbit
Immunogen speciesHuman
Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
IsotypeIgG
Speciescanine, hamster, human, monkey, mouse, rat
FormLiquid
FormulationIn PBS, 50% glycerol, pH 7.2.
Preservative≤0.1% sodium azide
CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Storage Avoid freeze/thaw
-20°C
Do Not Freeze Ok to freeze
Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
Toxicity Standard Handling
ReferencesMaines, M.D. 1988 FASEB J. 2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.