Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

Overview

Key Spec Table

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
05-23-2005-0.5MG
Retrieving availability...
Fulfillment and delivery delayed
Fulfillment and delivery delayed
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Glass bottle .5 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      05-23-2005-1MG
      Fulfillment and delivery delayed
Fulfillment and delivery delayed
      In Stock 
      Discontinued
      Limited Quantities Available
      Availability to be confirmed
        Remaining : Will advise
          Remaining : Will advise
          Will advise
          Contact Customer Service
          Contact Customer Service

          Plastic ampoule 1 mg
          Price could not be retrieved
          Minimum Quantity is a multiple of
          Maximum Quantity is
          Upon Order Completion More Information
          You Saved ()
           
          Request Pricing
          Description
          OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          Catalogue Number05-23-2005
          Brand Family Calbiochem®
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          References
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Product Information
          CAS number90880-35-6
          ATP CompetitiveN
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          ReversibleY
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Biological Information
          Primary TargetA potent vasoconstrictor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Safety Information
          R PhraseR: 20/21/22

          Harmful by inhalation, in contact with skin and if swallowed.
          S PhraseS: 36

          Wear suitable protective clothing.
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Harmful
          Storage -20°C
          Protect from Moisture Protect from moisture
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Global Trade Item Number
          Catalogue Number GTIN
          05-23-2005-0.5MG 04055977206371
          05-23-2005-1MG 04055977206388