Millipore Sigma Vibrant Logo

MAB2291 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3

View Products on Sigmaaldrich.com
MAB2291
100 µg  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Fulfillment and delivery delayed
Fulfillment and delivery delayed
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      HWB, ICC, IHCMPurifiedMonoclonal Antibody
      Description
      Catalogue NumberMAB2291
      Brand Family Chemicon®
      Trade Name
      • Chemicon
      DescriptionAnti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3
      OverviewMAB2291 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3B.
      Alternate Names
      • CD49c
      Background InformationIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.
      References
      Product Information
      FormatPurified
      PresentationPurified. Liquid in PBS containing 0.1% sodium azide.
      Quality LevelMQ100
      Applications
      ApplicationThis Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3 is validated for use in WB, IC, IH for the detection of Integrin α3.
      Key Applications
      • Western Blotting
      • Immunocytochemistry
      • Immunohistochemistry
      Application NotesWestern Blotting

      Immunocytochemistry

      Immunohistochemistry

      Optimal working dilutions must be determined by the end user.
      Biological Information
      ImmunogenSynthetic peptide: CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK
      Epitopecytoplasmic domain
      Clone54B3
      ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
      HostMouse
      SpecificityAnti-Integrin alpha 3B recognizes the cytoplasmic domain of integrin alpha 3B. Integrin alpha 3B is present in the microvascular structures in brain and heart.

      SPECIES REACTIVITIES:

      Although untested, a broad species reactivity is expected due to the conserved nature of the epitope.
      IsotypeIgG1
      Species Reactivity
      • Human
      Antibody TypeMonoclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 ('VLA-3'), very common antigen 2 ('VCA-2'), extracellular matrix receptor 1 ('ECMR1'), and galactoprotein b3 ('GAPB3').
      Gene Symbol
      • ITGA3
      • FRP-2
      • GAP-B3
      • CD49c
      • FLJ34704
      • MSK18
      • VL3A
      • VLA3a
      • GAPB3
      • CD49C
      • VCA-2
      • FLJ34631
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P26006 # Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha- 3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.
      SIZE: 1066 amino acids; 118698 Da
      SUBUNIT: Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.
      SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
      TISSUE SPECIFICITY: Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells.
      PTM: Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12- myristate 13-acetate stimulation.
      SIMILARITY: SwissProt: P26006 ## Belongs to the integrin alpha chain family. & Contains 7 FG-GAP repeats.
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsStore at 2-8°C, or in small aliquots at -20°C.
      Packaging Information
      Material Size100 µg
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      MAB2291 04053252466403

      Related Products & Applications

      Related Products

      Catalogue Number Description  
      AB1920 Anti-Integrin α3 Antibody Show Pricing & Availability
      MAB1952Z Anti-Integrin α3 Antibody, clone P1B5, azide free Show Pricing & Availability
      MAB1992 Anti-Integrin α3β1 Antibody, clone M-KID2 Show Pricing & Availability
      MAB2056 Anti-Integrin α3 Antibody, clone ASC-1 Show Pricing & Availability
      MAB2056Z Anti-Integrin α3 Antibody, clone ASC-1 (Azide Free) Show Pricing & Availability
      MAB2057 Anti-Integrin α3 Antibody, clone ASC-6 Show Pricing & Availability
      MAB2290 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 Show Pricing & Availability

      Categories

      Life Science Research > Antibodies and Assays > Primary Antibodies