05-23-2151 Sigma-AldrichPACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem
Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).
More>> Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM). Less<<Synonyme: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Empfohlene Produkte
Übersicht
Replacement Information |
---|
Key Spec Table
CAS # | Empirical Formula |
---|---|
127317-03-7 | C₁₄₂H₂₂₄N₄₀O₃₉S |
Preis & Verfügbarkeit
Bestellnummer | Verfügbarkeit | Verpackung | St./Pkg. | Preis | Menge | |
---|---|---|---|---|---|---|
05-23-2151-0.5MG |
|
Glasflasche | .5 mg |
|
— |
References | |
---|---|
References | Kobayashi, H., et al. 1994. Brain Res. 647, 145. Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027. |
Product Information | |
---|---|
CAS number | 127317-03-7 |
ATP Competitive | N |
Form | White to off-white solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₁₄₂H₂₂₄N₄₀O₃₉S |
Chemical formula | C₁₄₂H₂₂₄N₄₀O₃₉S |
Hygroscopic | Hygroscopic |
Reversible | N |
Sold on the basis of peptide content | Y |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | Increases cAMP levels |
Primary Target IC<sub>50</sub> | EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner |
Purity | ≥97% by HPLC |
Physicochemical Information | |
---|---|
Cell permeable | N |
Peptide Content | Y |
Peptide Sequence | H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Bestellnummer | GTIN |
05-23-2151-0.5MG | 04055977226676 |
Documentation
PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem SDB
Titel |
---|
PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Analysenzertifikate
Titel | Chargennummer |
---|---|
05-23-2151 |
Literatur
Übersicht |
---|
Kobayashi, H., et al. 1994. Brain Res. 647, 145. Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027. |