Millipore Sigma Vibrant Logo

171596 β-Amyloid Peptide (1-42), Rat

Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

β-Amyloid Peptide (1-42), Rat: SDB (Sicherheitsdatenblätter), Analysenzertifikate und Qualitätszertifikate, Dossiers, Broschüren und andere verfügbare Dokumente.

Synonyme: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

View Products on Sigmaaldrich.com
171596
Preis & Verfügbarkeit

Übersicht

Replacement Information

Preis & Verfügbarkeit

Bestellnummer VerfügbarkeitVerpackung St./Pkg. Preis Menge
171596-250UG
Verfügbarkeit wird abgerufen...
—
Eingeschränkte Verfügbarkeit Eingeschränkte Verfügbarkeit
Lieferbar 
Produkt wurde eingestellt
Begrenzter Lagerbestand
Bestätigung der Verfügbarkeit erforderlich
    Restmenge: Angebot folgt
      Restmenge: Angebot folgt
      Bitte erfragen
      Kontakt zum Kundenservice
      Contact Customer Service

      		 Kst.-Ampulle 250 μg
      Preis wird abgerufen...
      Preis nicht abrufbar
      Die Mindestmenge muss ein Vielfaches sein von
      Maximum Quantity is
      Bei Bestätigung Weitere Informationen
      Sie haben () gespart
       
      —
      Bitte erfragen
      		 —
      Description
      OverviewPredominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
      Catalogue Number171596
      Brand Family Calbiochem®
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      References
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.
      Product Information
      CAS number107761-42-2
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Hygroscopic Hygroscopic
      Quality LevelMQ100
      Applications
      Biological Information
      Purity≥80% by HPLC
      Physicochemical Information
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Bestellnummer GTIN
      171596-250UG 04055977207286

      Documentation

      β-Amyloid Peptide (1-42), Rat SDB

      Titel

      Sicherheitsdatenblatt (SDB) 

      β-Amyloid Peptide (1-42), Rat Analysenzertifikate

      TitelChargennummer
      171596

      Literatur

      Übersicht
      Paradis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.

      Broschüre

      Titel
      Alzheimer's Disease Brochure & Technical Guide
      Datenblatt

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision14-April-2008 RFH
      SynonymsDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      Descriptionβ-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer's diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.
      FormLyophilized
      FormulationSupplied as a trifluoroacetate salt.
      CAS number107761-42-2
      Chemical formulaC₁₉₉H₃₀₇N₅₃O₅₉S
      Peptide SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
      Purity≥80% by HPLC
      Solubility5% Acetic Acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesParadis, E., et al. 1996. J. Neurosci. 16, 7533.
      Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631.
      Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701.
      Murrell, J., et al. 1991. Science 254, 97.
      Goldgaber, D., et al. 1987. Science 235, 877.
      Kang, J., et al. 1987. Nature 325, 733.