Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

196350 Bak BH3 Fusion Peptide, Cell-Permeable

A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.

Bak BH3 Fusion Peptide, Cell-Permeable MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3

Primary Target: Bcl-xL
196350
  
Purchase on Sigma-Aldrich

Přehled

Replacement Information

Tabulka spec. kláve

Empirical Formula
C₁₉₆H₃₂₁N₆₅O₄₇S₂
Description
Overview

This product has been discontinued.





A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases.
Catalogue Number196350
Brand Family Calbiochem®
SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
References
ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.
Product Information
ATP CompetitiveN
FormOff-white lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
Hygroscopic Hygroscopic
ReversibleN
Applications
Biological Information
Primary TargetBcl-xL
Purity≥95% by HPLC
Physicochemical Information
Cell permeableY
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Katalogové číslo GTIN
196350 0

Documentation

Bak BH3 Fusion Peptide, Cell-Permeable Certificates of Analysis

TitleLot Number
196350

References

Přehled odkazů
Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.

Brochure

Title
Caspases and other Apoptosis Related Tools Brochure
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision17-April-2008 RFH
SynonymsRQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
DescriptionA cell-permeable peptide consisting of the Bcl-2 homology 3 (BH3) domain from Bak and the internalization sequence from the Antennapedia (Ant). Selectively binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis (~50 µM) in HeLa cells. May function through the formation of inactive dimers with death suppressors. Induction of apoptosis with Ant-BH3 is reported to occur in about 2-3 h via cytochrome c-independent induction of caspases.
FormOff-white lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Intert gas (Yes/No) Packaged under inert gas
Chemical formulaC₁₉₆H₃₂₁N₆₅O₄₇S₂
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH
Purity≥95% by HPLC
SolubilityDMSO (10 mg/ml)
Storage -20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze at -20°C. Stock solutions are stable for up to 1 month at -20°C.
Toxicity Standard Handling
ReferencesHolinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298.
Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913.