Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

05-23-2150 PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem

05-23-2150
Purchase on Sigma-Aldrich

Overview

Key Spec Table

CAS #Empirical Formula
137061-48-4C₂₀₃H₃₃₁N₆₃O₅₃S

Products

Catalogue NumberPackaging Qty/Pack
05-23-2150-0.1MGCN Plastic ampoule .1 mg
Description
OverviewMore active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM).
Catalogue Number05-23-2150
Brand Family Calbiochem®
SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
References
ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81.
Product Information
CAS number137061-48-4
ATP CompetitiveN
FormWhite to off-white solid
Hill FormulaC₂₀₃H₃₃₁N₆₃O₅₃S
Chemical formulaC₂₀₃H₃₃₁N₆₃O₅₃S
Hygroscopic Hygroscopic
ReversibleN
Sold on the basis of peptide contentY
Quality LevelMQ100
Biological Information
Primary TargetAdenylate cyclase
Primary Target IC<sub>50</sub>EC50 = 7 nM against adenylate cyclase
Purity≥96% by HPLC
Physicochemical Information
Cell permeableN
Peptide ContentY
Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Global Trade Item Number
Catalogue Number GTIN
05-23-2150-0.1MGCN 04055977226652