Millipore Sigma Vibrant Logo

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

MSDS (material safety data sheet) o SDS, certificato d’analisi (CoA) e certificato di qualità (CoQ), dossier, brochure e altri documenti disponibili.

Sinonimi: Ant-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)

Primary Target: Control for TIRAP inhibitor
View Products on Sigmaaldrich.com
613571
Visualizza prezzi e disponibilità

Panoramica

Replacement Information

Tabella delle specifiche principali

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Prezzi e disponibilità

Numero di catalogo DisponibilitàConfezionamento Qtà/conf Prezzo Quantità
613571-1MG
Verifica della disponibilità in corso...
—
Disponibilità limitata Disponibilità limitata
A magazzino 
Fuori produzione
Disponibili quantità limitate
La disponibilità deve essere confermata
    Prodotti rimanenti: riceverà un nostro avviso
      Prodotti rimanenti: riceverà un nostro avviso
      Will advise
      Contatti il Servizio Clienti
      Contact Customer Service

      		 Fiala di plastica 1 mg
      Ricerca del prezzo in corso...
      Non è stato possibile trovare il prezzo
      La quantità minima deve essere un multiplo di
      Maximum Quantity is
      Al termine dell'ordine Maggiori informazioni
      Lei ha salvato ()
       
      —
      Richiedi il prezzo
      		 —
      Description
      OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      Catalogue Number613571
      Brand Family Calbiochem®
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      References
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetControl for TIRAP inhibitor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Numero di catalogo GTIN
      613571-1MG 04055977263565

      Documentation

      TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem MSDS

      Titolo

      Scheda di sicurezza (MSDS) 

      TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem Certificati d'Analisi

      TitoloNumero di lotto
      613571

      Riferimenti bibliografici

      Panoramica delle referenze
      Horng, T., et al. 2001. Nat. Immunol. 2, 835.
      Scheda tecnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-September-2008 RFH
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      DescriptionA cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Purity≥97% by HPLC
      SolubilityDMSO (5 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.