Millipore Sigma Vibrant Logo

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

View Products on Sigmaaldrich.com
613571
Visualizza prezzi e disponibilità

Panoramica

Tabella delle specifiche principali

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Prezzi e disponibilità

Numero di catalogo DisponibilitàConfezionamento Qtà/conf Prezzo Quantità
613571-1MG
Disponibilità limitata
Disponibilità limitata
A magazzino 
Fuori produzione
Disponibili quantità limitate
La disponibilità deve essere confermata
    Prodotti rimanenti: riceverà un nostro avviso
      Prodotti rimanenti: riceverà un nostro avviso
      Will advise
      Contatti il Servizio Clienti
      Contact Customer Service

      Fiala di plastica 1 mg
      Non è stato possibile trovare il prezzo
      La quantità minima deve essere un multiplo di
      Maximum Quantity is
      Al termine dell'ordine Maggiori informazioni
      Lei ha salvato ()
       
      Richiedi il prezzo
      Description
      OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      Catalogue Number613571
      Brand Family Calbiochem®
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      References
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Biological Information
      Primary TargetControl for TIRAP inhibitor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Global Trade Item Number
      Numero di catalogo GTIN
      613571-1MG 04055977263565