Millipore Sigma Vibrant Logo

05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

MSDS (material safety data sheet) o SDS, certificato d’analisi (CoA) e certificato di qualità (CoQ), dossier, brochure e altri documenti disponibili.

Sinonimi: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂

Primary Target: Increases cAMP levels
View Products on Sigmaaldrich.com
05-23-2151
Visualizza prezzi e disponibilità

Panoramica

Replacement Information

Tabella delle specifiche principali

CAS #Empirical Formula
127317-03-7C₁₄₂H₂₂₄N₄₀O₃₉S

Prezzi e disponibilità

Numero di catalogo DisponibilitàConfezionamento Qtà/conf Prezzo Quantità
05-23-2151-0.5MG
Verifica della disponibilità in corso...
—
Disponibilità limitata Disponibilità limitata
A magazzino 
Fuori produzione
Disponibili quantità limitate
La disponibilità deve essere confermata
    Prodotti rimanenti: riceverà un nostro avviso
      Prodotti rimanenti: riceverà un nostro avviso
      Will advise
      Contatti il Servizio Clienti
      Contact Customer Service

      		 Bottiglia di vetro .5 mg
      Ricerca del prezzo in corso...
      Non è stato possibile trovare il prezzo
      La quantità minima deve essere un multiplo di
      Maximum Quantity is
      Al termine dell'ordine Maggiori informazioni
      Lei ha salvato ()
       
      —
      Richiedi il prezzo
      		 —
      Description
      OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      Catalogue Number05-23-2151
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Product Information
      CAS number127317-03-7
      ATP CompetitiveN
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetIncreases cAMP levels
      Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Numero di catalogo GTIN
      05-23-2151-0.5MG 04055977226676

      Documentation

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem MSDS

      Titolo

      Scheda di sicurezza (MSDS) 

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Certificati d'Analisi

      TitoloNumero di lotto
      05-23-2151

      Riferimenti bibliografici

      Panoramica delle referenze
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Scheda tecnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-September-2022 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number127317-03-7
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.