Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

A potent vasoconstrictor.

FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂

Primary Target: A potent vasoconstrictor
View Products on Sigmaaldrich.com
05-23-2005
Voir les Prix & la Disponibilité

Aperçu

Replacement Information

Tableau de caractéristiques principal

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Prix & Disponibilité

Référence DisponibilitéConditionnement Qté Prix Quantité
05-23-2005-0.5MG
Récupération des données relatives à la disponibilité...
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

      		 Flacon en verre .5 mg
      Prix en cours de récupération
      Le prix n'a pas pu être récupéré
      La quantité minimale doit être un multiple de
      Maximum Quantity is
      À la validation de la commande Plus d'informations
      Vous avez sauvegardé ()
       
      —
      Demander le prix
      		 —
      05-23-2005-1MG
      Récupération des données relatives à la disponibilité...
      —
      Disponibilité limitée Disponibilité limitée
      En stock 
      Interrompu(e)
      Disponible en quantités limitées
      Disponibilité à confirmer
        Pour le restant : Nous vous tiendrons informé
          Pour le restant : Nous vous tiendrons informé
          Nous vous tiendrons informé
          Contacter le Service Clients
          Contact Customer Service

          		 Ampoule plast. 1 mg
          Prix en cours de récupération
          Le prix n'a pas pu être récupéré
          La quantité minimale doit être un multiple de
          Maximum Quantity is
          À la validation de la commande Plus d'informations
          Vous avez sauvegardé ()
           
          —
          Demander le prix
          		 —
          Description
          OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          Catalogue Number05-23-2005
          Brand Family Calbiochem®
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          References
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Product Information
          CAS number90880-35-6
          ATP CompetitiveN
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          ReversibleY
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetA potent vasoconstrictor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          R PhraseR: 20/21/22

          Harmful by inhalation, in contact with skin and if swallowed.
          S PhraseS: 36

          Wear suitable protective clothing.
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Harmful
          Storage -20°C
          Protect from Moisture Protect from moisture
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications
          Global Trade Item Number
          Référence GTIN
          05-23-2005-0.5MG 04055977206371
          05-23-2005-1MG 04055977206388

          Documentation

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem FDS

          Titre

          Fiche de données de sécurité des matériaux (FDS) 

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificats d'analyse

          TitreNuméro de lot
          05-23-2005

          Références bibliographiques

          Aperçu de la référence bibliographique
          Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Fiche technique

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision18-September-2008 RFH
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          CAS number90880-35-6
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Purity≥97% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage Protect from moisture
          -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Harmful
          Merck USA index14, 6485
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.